Gene/Proteome Database (LMPD)
Proteins
Eri1p | |
---|---|
Refseq ID | NP_690846 |
Protein GI | 23270400 |
UniProt ID | P62651 |
mRNA ID | NM_001184515 |
Length | 68 |
RefSeq Status | PROVISIONAL |
MRPRDQGFLVLGFTYSVLLISLATFYWLRNNDSFLHYWCVLLLCPATLWLWALIAWCDSEMFASSKDE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005789 | IDA:SGD | C | endoplasmic reticulum membrane |
GO:0000506 | IPI:SGD | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005095 | IPI:SGD | F | GTPase inhibitor activity |
GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
GO:0043086 | IPI:GOC | P | negative regulation of catalytic activity |
GO:0007265 | IMP:SGD | P | Ras protein signal transduction |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Disruption Phenotype | Defects cause hyperactive Ras phenotypes, probably due to diminished GPI-anchor protein production. {ECO:0000269|PubMed:12832483}. |
Function | Probable component of the GPI-GlcNAc transferase (GPI- GnT) complex in the endoplasmic reticulum, a complex that catalyzes transfer of GlcNAc from UDP-GlcNAc to an acceptor phosphatidylinositol, the first step in the production of GPI- anchors for cell surface proteins. Ras may inhibit the enzyme activity of the GPI-GnT complex via the association between ERI1 and RAS2. {ECO:0000269|PubMed:12832483, ECO:0000269|PubMed:15163411}. |
Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:12832483}; Multi-pass membrane protein {ECO:0000269|PubMed:12832483}. |
Subunit | Interacts with GTP-bound RAS2 in an effector loop- dependent manner. Interacts with GPI2, suggesting that it is a component of the GPI-GnT complex, probably composed of GPI1, GPI2, GPI3, GPI15 and ERI1. {ECO:0000269|PubMed:12832483, ECO:0000269|PubMed:15163411}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006885 (as displayed in Record Overview)
Identical Sequences to LMP006885 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:23270400 | DBBJ | GAA26877.1 | 68 | K7_Eri1p [Saccharomyces cerevisiae Kyokai no. 7] |
GI:23270400 | GenBank | EWG85599.1 | 68 | Eri1p [Saccharomyces cerevisiae R008] |
GI:23270400 | GenBank | EWG88448.1 | 68 | Eri1p [Saccharomyces cerevisiae P301] |
GI:23270400 | GenBank | EWG92732.1 | 68 | Eri1p [Saccharomyces cerevisiae R103] |
GI:23270400 | GenBank | EWH15781.1 | 68 | Eri1p [Saccharomyces cerevisiae P283] |
GI:23270400 | gnl | McCuskerlabDuke | 68 | Eri1p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP006885 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:23270400 | GenBank | EDO14349.1 | 68 | hypothetical protein Kpol_1074p2 [Vanderwaltozyma polyspora DSM 70294] |
GI:23270400 | GenBank | EDV11124.1 | 68 | phosphatidylinositol N-acetylglucosaminyltransferase ERI1 subunit [Saccharomyces cerevisiae RM11-1a] |
GI:23270400 | GenBank | EJS41446.1 | 68 | eri1p [Saccharomyces arboricola H-6] |
GI:23270400 | GenBank | EJT43108.1 | 68 | ERI1-like protein [Saccharomyces kudriavzevii IFO 1802] |
GI:23270400 | RefSeq | XP_001642207.1 | 68 | hypothetical protein Kpol_1074p2 [Vanderwaltozyma polyspora DSM 70294] |
GI:23270400 | RefSeq | XP_003679063.1 | 67 | hypothetical protein TDEL_0A05200 [Torulaspora delbrueckii] |