Gene/Proteome Database (LMPD)
Proteins
delta(24(24(1)))-sterol reductase | |
---|---|
Refseq ID | NP_011503 |
Protein GI | 6321426 |
UniProt ID | P25340 |
mRNA ID | NM_001180877 |
Length | 473 |
MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGMLIGFPLLMYYMWICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKYDWTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWTLYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTCAIISGFAFSIILYLWTLFISHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTLYFITLGACLKQWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSCGFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF |
Gene Information
Entrez Gene ID
Gene Name
delta(24(24(1)))-sterol reductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0000246 | IDA:SGD | F | delta24(24-1) sterol reductase activity |
GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
M00102 | Ergocalciferol biosynthesis |
sce_M00102 | Ergocalciferol biosynthesis |
sce01100 | Metabolic pathways |
ko00100 | Steroid biosynthesis |
sce00100 | Steroid biosynthesis |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY-6075 | ergosterol biosynthesis |
PWY-6075 | ergosterol biosynthesis I |
ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis |
ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis I |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta(24(24(1)))-sterol reductase
Protein Entry
ERG4_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Catalytic Activity | Ergosterol + NADP(+) = ergosta- 5,7,22,24(24(1))-tetraen-3-beta-ol + NADPH. |
Caution | Was originally thought to be a transport protein |
Caution | Was originally thought to be a transport protein. {ECO:0000305|PubMed:1882555}. |
Miscellaneous | Present with 1640 molecules/cell in log phase SD medium |
Miscellaneous | Present with 1640 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 5/5. |
Similarity | Belongs to the ERG4/ERG24 family |
Similarity | Belongs to the ERG4/ERG24 family. {ECO:0000305}. |
Subcellular Location | Membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006892 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6321426 | RefSeq | NP_011503 | 473 | delta(24(24(1)))-sterol reductase |
Identical Sequences to LMP006892 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP006892 proteins
Reference | Database | Accession | Length | Protein Name |
---|