Gene/Proteome Database (LMPD)
Proteins
| delta(24(24(1)))-sterol reductase | |
|---|---|
| Refseq ID | NP_011503 |
| Protein GI | 6321426 |
| UniProt ID | P25340 |
| mRNA ID | NM_001180877 |
| Length | 473 |
| MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGMLIGFPLLMYYMWICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKYDWTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWTLYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTCAIISGFAFSIILYLWTLFISHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTLYFITLGACLKQWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSCGFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF | |
Gene Information
Entrez Gene ID
Gene Name
delta(24(24(1)))-sterol reductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0000246 | IDA:SGD | F | delta24(24-1) sterol reductase activity |
| GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| M00102 | Ergocalciferol biosynthesis |
| sce_M00102 | Ergocalciferol biosynthesis |
| sce01100 | Metabolic pathways |
| ko00100 | Steroid biosynthesis |
| sce00100 | Steroid biosynthesis |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-6075 | ergosterol biosynthesis |
| PWY-6075 | ergosterol biosynthesis I |
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis |
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis I |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
delta(24(24(1)))-sterol reductase
Protein Entry
ERG4_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Ergosterol + NADP(+) = ergosta- 5,7,22,24(24(1))-tetraen-3-beta-ol + NADPH. |
| Caution | Was originally thought to be a transport protein |
| Caution | Was originally thought to be a transport protein. {ECO:0000305|PubMed:1882555}. |
| Miscellaneous | Present with 1640 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1640 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 5/5. |
| Similarity | Belongs to the ERG4/ERG24 family |
| Similarity | Belongs to the ERG4/ERG24 family. {ECO:0000305}. |
| Subcellular Location | Membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006892 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6321426 | RefSeq | NP_011503 | 473 | delta(24(24(1)))-sterol reductase |
Identical Sequences to LMP006892 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006892 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|