Gene/Proteome Database (LMPD)

LMPD ID
LMP006892
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
delta(24(24(1)))-sterol reductase
Gene Symbol
Synonyms
-
Chromosome
VII
EC Number
1.3.1.71

Proteins

delta(24(24(1)))-sterol reductase
Refseq ID NP_011503
Protein GI 6321426
UniProt ID P25340
mRNA ID NM_001180877
Length 473
MAKDNSEKLQVQGEEKKSKQPVNFLPQGKWLKPNEIEYEFGGTTGVIGMLIGFPLLMYYMWICAEFYHGKVALPKAGESWMHFIKHLYQLVLENGIPEKYDWTIFLTFWVFQIIFYYTLPGIWTKGQPLSHLKGKQLPYFCNAMWTLYVTTTLVLVLHFTNLFRLYVIIDRFGRIMTCAIISGFAFSIILYLWTLFISHDYHRMTGNHLYDFFMGAPLNPRWGILDLKMFFEVRLPWFTLYFITLGACLKQWETYGYVTPQLGVVMLAHWLYANACAKGEELIVPTWDMAYEKFGFMLIFWNIAGVPYTYCHCTLYLYYHDPSEYHWSTLYNVSLYVVLLCAYYFFDTANAQKNAFRKQMSGDKTGRKTFPFLPYQILKNPKYMVTSNGSYLLIDGWYTLARKIHYTADWTQSLVWALSCGFNSVFPWFFPVFFLVVLIHRAFRDQAKCKRKYGKDWDEYCKHCPYVFIPYVF

Gene Information

Entrez Gene ID
Gene Name
delta(24(24(1)))-sterol reductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:SGD C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0000246 IDA:SGD F delta24(24-1) sterol reductase activity
GO:0006696 IMP:SGD P ergosterol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
M00102 Ergocalciferol biosynthesis
sce_M00102 Ergocalciferol biosynthesis
sce01100 Metabolic pathways
ko00100 Steroid biosynthesis
sce00100 Steroid biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6075 ergosterol biosynthesis
PWY-6075 ergosterol biosynthesis I
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis I

REACTOME Pathway Links

REACTOME Pathway ID Description
5618346 Cholesterol biosynthesis
5618023 Metabolism
5618091 Metabolism of lipids and lipoproteins

Domain Information

InterPro Annotations

Accession Description
IPR001171 Ergosterol biosynthesis ERG4/ERG24
IPR018083 Sterol reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
delta(24(24(1)))-sterol reductase
Protein Entry
ERG4_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity Ergosterol + NADP(+) = ergosta- 5,7,22,24(24(1))-tetraen-3-beta-ol + NADPH.
Caution Was originally thought to be a transport protein
Caution Was originally thought to be a transport protein. {ECO:0000305|PubMed:1882555}.
Miscellaneous Present with 1640 molecules/cell in log phase SD medium
Miscellaneous Present with 1640 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Steroid metabolism; ergosterol biosynthesis; ergosterol from zymosterol: step 5/5.
Similarity Belongs to the ERG4/ERG24 family
Similarity Belongs to the ERG4/ERG24 family. {ECO:0000305}.
Subcellular Location Membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP006892 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6321426 RefSeq NP_011503 473 delta(24(24(1)))-sterol reductase

Identical Sequences to LMP006892 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP006892 proteins

Reference Database Accession Length Protein Name