Gene/Proteome Database (LMPD)

LMPD ID
LMP006955
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase
Gene Symbol
Synonyms
-
Chromosome
VIII
EC Number
2.5.1.21

Proteins

bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase
Refseq ID NP_012060
Protein GI 6321984
UniProt ID P29704
mRNA ID NM_001179321
Length 444
MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIRELHPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDRAVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCHYVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPKEIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQVMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQDPNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYKFNMVLSIILSVLLGFYYIYTLHRA

Gene Information

Entrez Gene ID
Gene Name
bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IDA:SGD C integral component of membrane
GO:0004310 IDA:SGD F farnesyl-diphosphate farnesyltransferase activity
GO:0016491 IEA:UniProtKB-KW F oxidoreductase activity
GO:0051996 IDA:SGD F squalene synthase activity
GO:0006696 IMP:SGD P ergosterol biosynthetic process
GO:0008299 IEA:UniProtKB-KW P isoprenoid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce01110 Biosynthesis of secondary metabolites
sce01100 Metabolic pathways
ko00909 Sesquiterpenoid and triterpenoid biosynthesis
sce00909 Sesquiterpenoid and triterpenoid biosynthesis
ko00100 Steroid biosynthesis
sce00100 Steroid biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5670 epoxysqualene biosynthesis
PWY-5670 epoxysqualene biosynthesis
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis
ERGOSTEROL-SYN-PWY superpathway of ergosterol biosynthesis I

REACTOME Pathway Links

REACTOME Pathway ID Description
5618346 Cholesterol biosynthesis
5618023 Metabolism
5618091 Metabolism of lipids and lipoproteins

Domain Information

InterPro Annotations

Accession Description
IPR006449 Farnesyl-diphosphate farnesyltransferase
IPR008949 Isoprenoid synthase domain
IPR002060 Squalene/phytoene synthase
IPR019845 Squalene/phytoene synthase, conserved site

UniProt Annotations

Entry Information

Gene Name
bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase
Protein Entry
FDFT_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity 2 farnesyl diphosphate + NAD(P)H = squalene + 2 diphosphate + NAD(P)(+).
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:8323279};
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ;
Function Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol. May also have a regulatory role regulating the flux of isoprene intermediates through the sterol pathway. Squalene synthase is crucial for balancing the incorporation of farnesyl diphosphate (FPP) into sterol and nonsterol isoprene synthesis. ERG9 is also essential for cell growth in yeast. {ECO:0000269|PubMed:1807826, ECO:0000269|PubMed:2068081, ECO:0000269|PubMed:8323279}.
Miscellaneous Present with 10800 molecules/cell in log phase SD medium
Miscellaneous Present with 10800 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 1/3.
Similarity Belongs to the phytoene/squalene synthase family
Similarity Belongs to the phytoene/squalene synthase family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome.

Identical and Related Proteins

Unique RefSeq proteins for LMP006955 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6321984 RefSeq NP_012060 444 bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase

Identical Sequences to LMP006955 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP006955 proteins

Reference Database Accession Length Protein Name