Gene/Proteome Database (LMPD)
Proteins
| bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase | |
|---|---|
| Refseq ID | NP_012060 |
| Protein GI | 6321984 |
| UniProt ID | P29704 |
| mRNA ID | NM_001179321 |
| Length | 444 |
| MGKLLQLALHPVEMKAALKLKFCRTPLFSIYDQSTSPYLLHCFELLNLTSRSFAAVIRELHPELRNCVTLFYLILRALDTIEDDMSIEHDLKIDLLRHFHEKLLLTKWSFDGNAPDVKDRAVLTDFESILIEFHKLKPEYQEVIKEITEKMGNGMADYILDENYNLNGLQTVHDYDVYCHYVAGLVGDGLTRLIVIAKFANESLYSNEQLYESMGLFLQKTNIIRDYNEDLVDGRSFWPKEIWSQYAPQLKDFMKPENEQLGLDCINHLVLNALSHVIDVLTYLAGIHEQSTFQFCAIPQVMAIATLALVFNNREVLHGNVKIRKGTTCYLILKSRTLRGCVEIFDYYLRDIKSKLAVQDPNFLKLNIQISKIEQFMEEMYQDKLPPNVKPNETPIFLKVKERSRYDDELVPTQQEEEYKFNMVLSIILSVLLGFYYIYTLHRA | |
Gene Information
Entrez Gene ID
Gene Name
bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IDA:SGD | C | integral component of membrane |
| GO:0004310 | IDA:SGD | F | farnesyl-diphosphate farnesyltransferase activity |
| GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
| GO:0051996 | IDA:SGD | F | squalene synthase activity |
| GO:0006696 | IMP:SGD | P | ergosterol biosynthetic process |
| GO:0008299 | IEA:UniProtKB-KW | P | isoprenoid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01110 | Biosynthesis of secondary metabolites |
| sce01100 | Metabolic pathways |
| ko00909 | Sesquiterpenoid and triterpenoid biosynthesis |
| sce00909 | Sesquiterpenoid and triterpenoid biosynthesis |
| ko00100 | Steroid biosynthesis |
| sce00100 | Steroid biosynthesis |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-5670 | epoxysqualene biosynthesis |
| PWY-5670 | epoxysqualene biosynthesis |
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis |
| ERGOSTEROL-SYN-PWY | superpathway of ergosterol biosynthesis I |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase
Protein Entry
FDFT_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 farnesyl diphosphate + NAD(P)H = squalene + 2 diphosphate + NAD(P)(+). |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence= ; |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000269|PubMed:8323279}; |
| Function | Catalyzes the condensation of 2 two farnesyl pyrophosphate moieties to form squalene. It is the first committed enzyme of the sterol biosynthesis pathway. Required for the biosynthesis of ergosterol. May also have a regulatory role regulating the flux of isoprene intermediates through the sterol pathway. Squalene synthase is crucial for balancing the incorporation of farnesyl diphosphate (FPP) into sterol and nonsterol isoprene synthesis. ERG9 is also essential for cell growth in yeast. {ECO:0000269|PubMed:1807826, ECO:0000269|PubMed:2068081, ECO:0000269|PubMed:8323279}. |
| Miscellaneous | Present with 10800 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 10800 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 1/3. |
| Similarity | Belongs to the phytoene/squalene synthase family |
| Similarity | Belongs to the phytoene/squalene synthase family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane; Multi-pass membrane protein. Microsome. |
Identical and Related Proteins
Unique RefSeq proteins for LMP006955 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6321984 | RefSeq | NP_012060 | 444 | bifunctional farnesyl-diphosphate farnesyltransferase/squalene synthase |
Identical Sequences to LMP006955 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP006955 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|