Gene/Proteome Database (LMPD)
Proteins
| dolichyl-phosphate beta-glucosyltransferase | |
|---|---|
| Refseq ID | NP_015097 |
| Protein GI | 6325029 |
| UniProt ID | P40350 |
| mRNA ID | NM_001184041 |
| Length | 334 |
| RefSeq Status | PROVISIONAL |
| MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC | |
Gene Information
Entrez Gene ID
Gene Name
dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005789 | IDA:SGD | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0004581 | IDA:SGD | F | dolichyl-phosphate beta-glucosyltransferase activity |
| GO:0006487 | IMP:UniProtKB | P | protein N-linked glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce00510 | N-Glycan biosynthesis |
| sce_M00055 | N-glycan precursor biosynthesis |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3O-1565 | dolichyl glucosyl phosphate biosynthesis |
| MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS | dolichyl-diphosphooligosaccharide biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
dolichyl-phosphate beta-glucosyltransferase
Protein Entry
ALG5_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-glucose + dolichyl phosphate = UDP + dolichyl beta-D-glucosyl phosphate. |
| Miscellaneous | Present with 5800 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 2 family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane; Single-pass type II membrane protein. Note=Its interaction with the substrate UDP-glucose may occur at the cytoplasmic side of the ER, whereas the steps utilizing dolichyl beta-D-glucosyl phosphate take place in the lumen of the ER. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007009 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6325029 | RefSeq | NP_015097 | 334 | dolichyl-phosphate beta-glucosyltransferase |
Identical Sequences to LMP007009 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6325029 | DBBJ | GAA26751.1 | 334 | K7_Alg5p [Saccharomyces cerevisiae Kyokai no. 7] |
| GI:6325029 | EMBL | CAA64260.1 | 334 | dolichyl-phosphate beta-glucosyltransferase [Saccharomyces cerevisiae] |
| GI:6325029 | EMBL | CAA97942.1 | 334 | ALG5 [Saccharomyces cerevisiae] |
| GI:6325029 | GenBank | EIW07310.1 | 334 | Alg5p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6325029 | SwissProt | P40350.1 | 334 | RecName: Full=Dolichyl-phosphate beta-glucosyltransferase; Short=DolP-glucosyltransferase; AltName: Full=Asparagine-linked glycosylation protein 5 [Saccharomyces cerevisiae S288c] |
| GI:6325029 | Third Party Genbank | DAA11209.1 | 334 | TPA: dolichyl-phosphate beta-glucosyltransferase [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007009 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6325029 | EMBL | CAY86733.1 | 334 | Alg5p [Saccharomyces cerevisiae EC1118] |
| GI:6325029 | GenBank | EEU05649.1 | 334 | Alg5p [Saccharomyces cerevisiae JAY291] |
| GI:6325029 | GenBank | EGA56458.1 | 334 | Alg5p [Saccharomyces cerevisiae FostersB] |
| GI:6325029 | GenBank | EGA80385.1 | 334 | Alg5p [Saccharomyces cerevisiae Lalvin QA23] |
| GI:6325029 | GenBank | EWG85483.1 | 334 | Alg5p [Saccharomyces cerevisiae R008] |
| GI:6325029 | GenBank | EWG88350.1 | 334 | Alg5p [Saccharomyces cerevisiae P301] |