Gene/Proteome Database (LMPD)

LMPD ID
LMP007009
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Synonyms
-
Alternate Names
dolichyl-phosphate beta-glucosyltransferase
Chromosome
XVI
EC Number
2.4.1.117

Proteins

dolichyl-phosphate beta-glucosyltransferase
Refseq ID NP_015097
Protein GI 6325029
UniProt ID P40350
mRNA ID NM_001184041
Length 334
RefSeq Status PROVISIONAL
MRALRFLIENRNTVFFTLLVALVLSLYLLVYLFSHTPRPPYPEELKYIAIDEKGHEVSRALPNLNEHQDDEEIFLSVVIPSYNETGRILLMLTDAISFLKEKYGSRWEIVIVDDGSTDNTTQYCLKICKEQFKLNYEQFRIIKFSQNRGKGGAVRQGFLHIRGKYGLFADADGASKFSDVEKLIDAISKIETSSTDLKTTKPAVAIGSRAHMVNTEAVIKRSMIRNCLMYGFHTLVFIFGIRSIKDTQCGFKLFNRAAILKIFPYLHTEGWIFDVEILILAIRKRIQIEEIPISWHEVDGSKMALAIDSIKMAKDLVIIRMAYLLGIYRDNKKC

Gene Information

Entrez Gene ID
Gene Name
dolichyl-phosphate beta-glucosyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005789 IDA:SGD C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0004581 IDA:SGD F dolichyl-phosphate beta-glucosyltransferase activity
GO:0006487 IMP:UniProtKB P protein N-linked glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
sce00510 N-Glycan biosynthesis
sce_M00055 N-glycan precursor biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY3O-1565 dolichyl glucosyl phosphate biosynthesis
MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS dolichyl-diphosphooligosaccharide biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001173 Glycosyltransferase 2-like
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
dolichyl-phosphate beta-glucosyltransferase
Protein Entry
ALG5_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity UDP-glucose + dolichyl phosphate = UDP + dolichyl beta-D-glucosyl phosphate.
Miscellaneous Present with 5800 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 2 family. {ECO:0000305}.
Subcellular Location Endoplasmic reticulum membrane; Single-pass type II membrane protein. Note=Its interaction with the substrate UDP-glucose may occur at the cytoplasmic side of the ER, whereas the steps utilizing dolichyl beta-D-glucosyl phosphate take place in the lumen of the ER.

Identical and Related Proteins

Unique RefSeq proteins for LMP007009 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6325029 RefSeq NP_015097 334 dolichyl-phosphate beta-glucosyltransferase

Identical Sequences to LMP007009 proteins

Reference Database Accession Length Protein Name
GI:6325029 DBBJ GAA26751.1 334 K7_Alg5p [Saccharomyces cerevisiae Kyokai no. 7]
GI:6325029 EMBL CAA64260.1 334 dolichyl-phosphate beta-glucosyltransferase [Saccharomyces cerevisiae]
GI:6325029 EMBL CAA97942.1 334 ALG5 [Saccharomyces cerevisiae]
GI:6325029 GenBank EIW07310.1 334 Alg5p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6325029 SwissProt P40350.1 334 RecName: Full=Dolichyl-phosphate beta-glucosyltransferase; Short=DolP-glucosyltransferase; AltName: Full=Asparagine-linked glycosylation protein 5 [Saccharomyces cerevisiae S288c]
GI:6325029 Third Party Genbank DAA11209.1 334 TPA: dolichyl-phosphate beta-glucosyltransferase [Saccharomyces cerevisiae S288c]

Related Sequences to LMP007009 proteins

Reference Database Accession Length Protein Name
GI:6325029 EMBL CAY86733.1 334 Alg5p [Saccharomyces cerevisiae EC1118]
GI:6325029 GenBank EEU05649.1 334 Alg5p [Saccharomyces cerevisiae JAY291]
GI:6325029 GenBank EGA56458.1 334 Alg5p [Saccharomyces cerevisiae FostersB]
GI:6325029 GenBank EGA80385.1 334 Alg5p [Saccharomyces cerevisiae Lalvin QA23]
GI:6325029 GenBank EWG85483.1 334 Alg5p [Saccharomyces cerevisiae R008]
GI:6325029 GenBank EWG88350.1 334 Alg5p [Saccharomyces cerevisiae P301]