Gene/Proteome Database (LMPD)
Proteins
Gpi15p | |
---|---|
Refseq ID | NP_014360 |
Protein GI | 37362689 |
UniProt ID | P53961 |
mRNA ID | NM_001182877 |
Length | 229 |
MISKEYEFGKTSILNRKKYTLVIDEDKNGNFIRFTVLPVSNRKFKKVKQNGRVEINMGIQYHQIVLILLLNILFYVICLRSRFLEHINRTFEVTIARSFQILIIMGLFALGTIILVRGPSVETVTIFKESGLQLSRVKGMVIFPQQWNRKFFEQVEFISNERIIDVVINEGFCRGFRVIFYLAAIVRKSSTLKLLFPSNLPSIDDQRLIYNISRKYLSKQEKPLSRPKD |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0000506 | ISA:SGD | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
GO:0016021 | ISM:SGD | C | integral component of membrane |
GO:0017176 | IEA:UniProtKB-EC | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR019328 | GPI-GlcNAc transferase complex, PIG-H component, conserved domain |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. |
Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis |
Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. {ECO:0000269|PubMed:11746600}. |
Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
Sequence Caution | Sequence=AAT93131.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAA95905.1; Type=Erroneous gene model prediction; Evidence= ; |
Sequence Caution | Sequence=AAT93131.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAA95905.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
Similarity | Belongs to the PIGH family |
Similarity | Belongs to the PIGH family. {ECO:0000305}. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Subunit | Component of a complex with GPI1, GPI2, GPI3, GPI15 and ERI1 |
Subunit | Component of a complex with GPI1, GPI2, GPI3, GPI15 and ERI1. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007095 (as displayed in Record Overview)
Identical Sequences to LMP007095 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007095 proteins
Reference | Database | Accession | Length | Protein Name |
---|