Gene/Proteome Database (LMPD)
Proteins
| Gpi15p | |
|---|---|
| Refseq ID | NP_014360 |
| Protein GI | 37362689 |
| UniProt ID | P53961 |
| mRNA ID | NM_001182877 |
| Length | 229 |
| MISKEYEFGKTSILNRKKYTLVIDEDKNGNFIRFTVLPVSNRKFKKVKQNGRVEINMGIQYHQIVLILLLNILFYVICLRSRFLEHINRTFEVTIARSFQILIIMGLFALGTIILVRGPSVETVTIFKESGLQLSRVKGMVIFPQQWNRKFFEQVEFISNERIIDVVINEGFCRGFRVIFYLAAIVRKSSTLKLLFPSNLPSIDDQRLIYNISRKYLSKQEKPLSRPKD | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0000506 | ISA:SGD | C | glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex |
| GO:0016021 | ISM:SGD | C | integral component of membrane |
| GO:0017176 | IEA:UniProtKB-EC | F | phosphatidylinositol N-acetylglucosaminyltransferase activity |
| GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR019328 | GPI-GlcNAc transferase complex, PIG-H component, conserved domain |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | UDP-N-acetyl-D-glucosamine + 1-phosphatidyl- 1D-myo-inositol = UDP + 6-(N-acetyl-alpha-D-glucosaminyl)-1- phosphatidyl-1D-myo-inositol. |
| Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis |
| Function | Part of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis. {ECO:0000269|PubMed:11746600}. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Sequence Caution | Sequence=AAT93131.1; Type=Erroneous gene model prediction; Evidence= ; Sequence=CAA95905.1; Type=Erroneous gene model prediction; Evidence= ; |
| Sequence Caution | Sequence=AAT93131.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; Sequence=CAA95905.1; Type=Erroneous gene model prediction; Evidence={ECO:0000305}; |
| Similarity | Belongs to the PIGH family |
| Similarity | Belongs to the PIGH family. {ECO:0000305}. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Subunit | Component of a complex with GPI1, GPI2, GPI3, GPI15 and ERI1 |
| Subunit | Component of a complex with GPI1, GPI2, GPI3, GPI15 and ERI1. {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007095 (as displayed in Record Overview)
Identical Sequences to LMP007095 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007095 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|