Gene/Proteome Database (LMPD)
Proteins
| Dfg10p | |
|---|---|
| Refseq ID | NP_012215 |
| Protein GI | 6322140 |
| UniProt ID | P40526 |
| mRNA ID | NM_001179399 |
| Length | 253 |
| RefSeq Status | PROVISIONAL |
| MYFDEEQLLKYTIYAYRLSFFVGICSLFIAKSCLPEFLQYGKTYRPKENSKYSSILERIKKFTVPKAYFSHFYYLATFLSLVTLYFYPKFPIVWIIFGHSLRRLYETLYVLHYTSNSRMNWSHYLVGIWFYSVLLLILNISLYKNSIPNTLNMNAFIIFCIASWDQYKNHVILANLVKYSLPTGRLFRLVCCPHYLDEIIIYSTLLPYEQEFYLTLVWVITSLTISALETKNYYRHKFKDNHVAPYAIIPFII | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | ISS:SGD | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0019408 | IMP:SGD | P | dolichol biosynthetic process |
| GO:0019348 | IMP:UniProtKB | P | dolichol metabolic process |
| GO:0006488 | IMP:UniProtKB | P | dolichol-linked oligosaccharide biosynthetic process |
| GO:0016095 | IMP:UniProtKB | P | polyprenol catabolic process |
| GO:0006486 | IEA:UniProtKB-UniPathway | P | protein glycosylation |
| GO:0007124 | IMP:SGD | P | pseudohyphal growth |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001104 | 3-oxo-5-alpha-steroid 4-dehydrogenase, C-terminal |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Ditrans,polycis-dolichol + NADP(+) = ditrans,polycis-polyprenol + NADPH. {ECO:0000269|PubMed:20637498}. |
| Disruption Phenotype | Suppression of filamentatous growth, defects in cell polarity, and cellular elongation, due to defects in N- glycosylation. {ECO:0000269|PubMed:20637498, ECO:0000269|PubMed:9055077}. |
| Function | Plays a key role in early steps of protein N-linked glycosylation by being required for the conversion of polyprenol into dolichol. Dolichols are required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used for N-glycosylation. Acts as a polyprenol reductase that promotes the reduction of the alpha-isoprene unit of polyprenols into dolichols in a NADP-dependent mechanism. {ECO:0000269|PubMed:20637498}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the steroid 5-alpha reductase family. Polyprenol reductase subfamily. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007195 (as displayed in Record Overview)
Identical Sequences to LMP007195 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322140 | EMBL | CAA86173.1 | 253 | unnamed protein product [Saccharomyces cerevisiae] |
| GI:6322140 | GenBank | EDN61445.1 | 253 | conserved protein [Saccharomyces cerevisiae YJM789] |
| GI:6322140 | SwissProt | P40526.1 | 253 | RecName: Full=Polyprenol reductase; AltName: Full=Protein DFG10 [Saccharomyces cerevisiae S288c] |
| GI:6322140 | Third Party Genbank | DAA08498.1 | 253 | TPA: Dfg10p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007195 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6322140 | EMBL | CAY80460.1 | 253 | Dfg10p [Saccharomyces cerevisiae EC1118] |
| GI:6322140 | GenBank | EDZ71497.1 | 253 | YIL049Wp-like protein [Saccharomyces cerevisiae AWRI1631] |
| GI:6322140 | GenBank | EEU05062.1 | 253 | Dfg10p [Saccharomyces cerevisiae JAY291] |
| GI:6322140 | GenBank | EGA78452.1 | 253 | Dfg10p [Saccharomyces cerevisiae Vin13] |
| GI:6322140 | GenBank | EGA86438.1 | 253 | Dfg10p [Saccharomyces cerevisiae VL3] |
| GI:6322140 | gnl | McCuskerlabDuke | 253 | Dfg10p [Saccharomyces cerevisiae YJM993] |