Gene/Proteome Database (LMPD)
Proteins
| putative serine/threonine-protein kinase PPG1 | |
|---|---|
| Refseq ID | NP_014429 |
| Protein GI | 398365711 |
| UniProt ID | P32838 |
| mRNA ID | NM_001183209 |
| Length | 368 |
| MELDECLERLYKAQLLPEVTVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFHDMLEIFQIGGPVPDTNYLFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYGFYTECLNKYGGNSRVWQYLTDIFDYLVLCCIIDDEIFCVHGGLSPNVQTIDQIKIIDRFREIPHDGAMADLVWSDPEENNNPTLDHPDNSGQHFQVSPRGAGYTFGRSVVEKFLRMNDMNRIYRAHQLCNEGYQIYFDGLVTTVWSAPNYCYRCGNKASILELYSKDQFYFNVFEEAPENKLLKENSMNDNALEDSISNPVANRKLIADYFEDDSASADGSTDPEMYIFSDVYQARSASNRHVDYFL | |
Gene Information
Entrez Gene ID
Gene Name
putative serine/threonine-protein kinase PPG1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0004722 | ISS:SGD | F | protein serine/threonine phosphatase activity |
| GO:0005977 | IMP:SGD | P | glycogen metabolic process |
| GO:0006470 | ISS:SGD | P | protein dephosphorylation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
putative serine/threonine-protein kinase PPG1
Protein Entry
PP2A4_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate. |
| Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 2 manganese ions per subunit. ; |
| Cofactor | Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 2 manganese ions per subunit. {ECO:0000250}; |
| Function | Involved in glycogen accumulation. |
| Miscellaneous | Present with 1960 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1960 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Ptm | Reversibly methyl esterified on Leu-368 by leucine carboxyl methyltransferase 1 (PPM1) and protein phosphatase methylesterase 1 (PPE1). Carboxyl methylation influences the affinity of the catalytic subunit for the different regulatory subunits, thereby modulating the PP2A holoenzyme's substrate specificity, enzyme activity and cellular localization. |
| Similarity | Belongs to the PPP phosphatase family. PP-2A subfamily |
| Similarity | Belongs to the PPP phosphatase family. PP-2A subfamily. {ECO:0000305}. |
| Subunit | Inactivated in a complex with phosphatase methylesterase PPE1 (PP2Ai). Interacts with phosphatase 2A activator RRD1, which can reactivate PP2Ai by dissociating the catalytic subunit from the complex. Interacts with TAP42. {ECO:0000269|PubMed:14551259, ECO:0000269|PubMed:15447631}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007215 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 398365711 | RefSeq | NP_014429 | 368 | putative serine/threonine-protein kinase PPG1 |
Identical Sequences to LMP007215 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007215 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|