Gene/Proteome Database (LMPD)

LMPD ID
LMP007215
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
putative serine/threonine-protein kinase PPG1
Gene Symbol
Synonyms
-
Chromosome
XIV
EC Number
3.1.3.16;

Proteins

putative serine/threonine-protein kinase PPG1
Refseq ID NP_014429
Protein GI 398365711
UniProt ID P32838
mRNA ID NM_001183209
Length 368
MELDECLERLYKAQLLPEVTVRALCFKLKEMLVKESNVIHIQTPVTVVGDMHGQFHDMLEIFQIGGPVPDTNYLFLGDYVDRGLYSVETIMLLIVLKLRYPSRIHLLRGNHESRQITQSYGFYTECLNKYGGNSRVWQYLTDIFDYLVLCCIIDDEIFCVHGGLSPNVQTIDQIKIIDRFREIPHDGAMADLVWSDPEENNNPTLDHPDNSGQHFQVSPRGAGYTFGRSVVEKFLRMNDMNRIYRAHQLCNEGYQIYFDGLVTTVWSAPNYCYRCGNKASILELYSKDQFYFNVFEEAPENKLLKENSMNDNALEDSISNPVANRKLIADYFEDDSASADGSTDPEMYIFSDVYQARSASNRHVDYFL

Gene Information

Entrez Gene ID
Gene Name
putative serine/threonine-protein kinase PPG1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004722 ISS:SGD F protein serine/threonine phosphatase activity
GO:0005977 IMP:SGD P glycogen metabolic process
GO:0006470 ISS:SGD P protein dephosphorylation

Domain Information

InterPro Annotations

Accession Description
IPR004843 Calcineurin-like phosphoesterase domain, apaH type
IPR029052 Metallo-dependent phosphatase-like
IPR006186 Serine/threonine-specific protein phosphatase/bis(5-nucleosyl)-tetraphosphatase

UniProt Annotations

Entry Information

Gene Name
putative serine/threonine-protein kinase PPG1
Protein Entry
PP2A4_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence= ; Note=Binds 2 manganese ions per subunit. ;
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000250}; Note=Binds 2 manganese ions per subunit. {ECO:0000250};
Function Involved in glycogen accumulation.
Miscellaneous Present with 1960 molecules/cell in log phase SD medium
Miscellaneous Present with 1960 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Ptm Reversibly methyl esterified on Leu-368 by leucine carboxyl methyltransferase 1 (PPM1) and protein phosphatase methylesterase 1 (PPE1). Carboxyl methylation influences the affinity of the catalytic subunit for the different regulatory subunits, thereby modulating the PP2A holoenzyme's substrate specificity, enzyme activity and cellular localization.
Similarity Belongs to the PPP phosphatase family. PP-2A subfamily
Similarity Belongs to the PPP phosphatase family. PP-2A subfamily. {ECO:0000305}.
Subunit Inactivated in a complex with phosphatase methylesterase PPE1 (PP2Ai). Interacts with phosphatase 2A activator RRD1, which can reactivate PP2Ai by dissociating the catalytic subunit from the complex. Interacts with TAP42. {ECO:0000269|PubMed:14551259, ECO:0000269|PubMed:15447631}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007215 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398365711 RefSeq NP_014429 368 putative serine/threonine-protein kinase PPG1

Identical Sequences to LMP007215 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007215 proteins

Reference Database Accession Length Protein Name