Gene/Proteome Database (LMPD)

LMPD ID
LMP007247
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
type 2C protein phosphatase PTC1
Gene Symbol
Synonyms
CWH47; KCS2; TPD1
Chromosome
IV
EC Number
3.1.3.16;

Proteins

type 2C protein phosphatase PTC1
Refseq ID NP_010278
Protein GI 398364893
UniProt ID P35182
mRNA ID NM_001180065
Length 281
MSNHSEILERPETPYDITYRVGVAENKNSKFRRTMEDVHTYVKNFASRLDWGYFAVFDGHAGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEITSEDKFLILACDGLWDVIDDQDACELIKDITEPNEAAKVLVRYALENGTTDNVTVMVVFL

Gene Information

Entrez Gene ID
Gene Name
type 2C protein phosphatase PTC1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:SGD C cytoplasm
GO:0005634 IDA:SGD C nucleus
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0004722 IDA:SGD F protein serine/threonine phosphatase activity
GO:0000173 IDA:SGD P inactivation of MAPK activity involved in osmosensory signaling pathway
GO:0000001 IMP:SGD P mitochondrion inheritance
GO:0000750 IMP:SGD P pheromone-dependent signal transduction involved in conjugation with cellular fusion
GO:0006470 IDA:SGD P protein dephosphorylation
GO:0006950 IEA:UniProtKB-KW P response to stress
GO:0006388 IMP:SGD P tRNA splicing, via endonucleolytic cleavage and ligation

Domain Information

InterPro Annotations

Accession Description
IPR015655 Protein phosphatase 2C
IPR001932 Protein phosphatase 2C (PP2C)-like domain
IPR000222 Protein phosphatase 2C, manganese/magnesium aspartate binding site

UniProt Annotations

Entry Information

Gene Name
type 2C protein phosphatase PTC1
Protein Entry
PP2C1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
Cofactor Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Note=Binds 2 magnesium or manganese ions per subunit. Manganese is about 20 times more efficient than magnesium.;
Function It has a serine and a weak tyrosine phosphatase activity with ratios of serine to tyrosine phosphatase activity as high as 200:1. It is essential for growth or germination at 37 degrees Celsius. May have a role in the heat shock response. Involved in tRNA splicing and cell separation.
Interaction Q12163:NBP2; NbExp=4; IntAct=EBI-12784, EBI-34713;
Miscellaneous Present with 1520 molecules/cell in log phase SD medium
Miscellaneous Present with 1520 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the PP2C family
Similarity Belongs to the PP2C family. {ECO:0000305}.
Subunit Interacts with NBP2 and PBS2
Subunit Interacts with NBP2 and PBS2. {ECO:0000269|PubMed:14685261}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007247 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398364893 RefSeq NP_010278 281 type 2C protein phosphatase PTC1

Identical Sequences to LMP007247 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007247 proteins

Reference Database Accession Length Protein Name