Gene/Proteome Database (LMPD)
Proteins
| type 2C protein phosphatase PTC1 | |
|---|---|
| Refseq ID | NP_010278 |
| Protein GI | 398364893 |
| UniProt ID | P35182 |
| mRNA ID | NM_001180065 |
| Length | 281 |
| MSNHSEILERPETPYDITYRVGVAENKNSKFRRTMEDVHTYVKNFASRLDWGYFAVFDGHAGIQASKWCGKHLHTIIEQNILADETRDVRDVLNDSFLAIDEEINTKLVGNSGCTAAVCVLRWELPDSVSDDSMDLAQHQRKLYTANVGDSRIVLFRNGNSIRLTYDHKASDTLEMQRVEQAGGLIMKSRVNGMLAVTRSLGDKFFDSLVVGSPFTTSVEITSEDKFLILACDGLWDVIDDQDACELIKDITEPNEAAKVLVRYALENGTTDNVTVMVVFL | |
Gene Information
Entrez Gene ID
Gene Name
type 2C protein phosphatase PTC1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:SGD | C | cytoplasm |
| GO:0005634 | IDA:SGD | C | nucleus |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0004722 | IDA:SGD | F | protein serine/threonine phosphatase activity |
| GO:0000173 | IDA:SGD | P | inactivation of MAPK activity involved in osmosensory signaling pathway |
| GO:0000001 | IMP:SGD | P | mitochondrion inheritance |
| GO:0000750 | IMP:SGD | P | pheromone-dependent signal transduction involved in conjugation with cellular fusion |
| GO:0006470 | IDA:SGD | P | protein dephosphorylation |
| GO:0006950 | IEA:UniProtKB-KW | P | response to stress |
| GO:0006388 | IMP:SGD | P | tRNA splicing, via endonucleolytic cleavage and ligation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
type 2C protein phosphatase PTC1
Protein Entry
PP2C1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate. |
| Cofactor | Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Note=Binds 2 magnesium or manganese ions per subunit. Manganese is about 20 times more efficient than magnesium.; |
| Function | It has a serine and a weak tyrosine phosphatase activity with ratios of serine to tyrosine phosphatase activity as high as 200:1. It is essential for growth or germination at 37 degrees Celsius. May have a role in the heat shock response. Involved in tRNA splicing and cell separation. |
| Interaction | Q12163:NBP2; NbExp=4; IntAct=EBI-12784, EBI-34713; |
| Miscellaneous | Present with 1520 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1520 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the PP2C family |
| Similarity | Belongs to the PP2C family. {ECO:0000305}. |
| Subunit | Interacts with NBP2 and PBS2 |
| Subunit | Interacts with NBP2 and PBS2. {ECO:0000269|PubMed:14685261}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007247 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 398364893 | RefSeq | NP_010278 | 281 | type 2C protein phosphatase PTC1 |
Identical Sequences to LMP007247 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007247 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|