Gene/Proteome Database (LMPD)
Proteins
| glucosamine 6-phosphate N-acetyltransferase | |
|---|---|
| Refseq ID | NP_116637 |
| Protein GI | 14318503 |
| UniProt ID | P43577 |
| mRNA ID | NM_001179949 |
| Length | 159 |
| MSLPDGFYIRRMEEGDLEQVTETLKVLTTVGTITPESFSKLIKYWNEATVWNDNEDKKIMQYNPMVIVDKRTETVAATGNIIIERKIIHELGLCGHIEDIAVNSKYQGQGLGKLLIDQLVTIGFDYGCYKIILDCDEKNVKFYEKCGFSNAGVEMQIRK | |
Gene Information
Entrez Gene ID
Gene Name
glucosamine 6-phosphate N-acetyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0004343 | IDA:SGD | F | glucosamine 6-phosphate N-acetyltransferase activity |
| GO:0006048 | IDA:SGD | P | UDP-N-acetylglucosamine biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko00520 | Amino sugar and nucleotide sugar metabolism |
| sce00520 | Amino sugar and nucleotide sugar metabolism |
| sce01110 | Biosynthesis of secondary metabolites |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| UDPNACETYLGALSYN-PWY | UDP-N-acetyl-D-glucosamine biosynthesis II |
| UDPNACETYLGALSYN-PWY | UDP-N-acetyl-D-glucosamine biosynthesis II |
| UDPNAGSYN-YEAST-PWY | UDP-N-acetylglucosamine biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5618350 | Asparagine N-linked glycosylation |
| 5618349 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
| 5618074 | Metabolism of proteins |
| 5618285 | Post-translational protein modification |
| 5618532 | Synthesis of UDP-N-acetyl-glucosamine |
| 5618348 | Synthesis of substrates in N-glycan biosythesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
glucosamine 6-phosphate N-acetyltransferase
Protein Entry
GNA1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acetyl-CoA + D-glucosamine 6-phosphate = CoA + N-acetyl-D-glucosamine 6-phosphate. |
| Miscellaneous | Present with 2550 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 2550 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D- glucosamine biosynthesis; N-acetyl-alpha-D-glucosamine 1-phosphate from alpha-D-glucosamine 6-phosphate (route I): step 1/2. |
| Similarity | Belongs to the acetyltransferase family. GNA1 subfamily |
| Similarity | Belongs to the acetyltransferase family. GNA1 subfamily. {ECO:0000305}. |
| Similarity | Contains 1 N-acetyltransferase domain |
| Similarity | Contains 1 N-acetyltransferase domain. {ECO:0000255|PROSITE-ProRule:PRU00532}. |
| Subunit | Homodimer |
| Subunit | Homodimer. {ECO:0000269|PubMed:11278591}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007257 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 14318503 | RefSeq | NP_116637 | 159 | glucosamine 6-phosphate N-acetyltransferase |
Identical Sequences to LMP007257 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007257 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|