Gene/Proteome Database (LMPD)
Proteins
| inositol polyphosphate multikinase | |
|---|---|
| Refseq ID | NP_010458 |
| Protein GI | 398365957 |
| UniProt ID | P07250 |
| mRNA ID | NM_001180480 |
| Length | 355 |
| RefSeq Status | PROVISIONAL |
| MDTVNNYRVLEHKAAGHDGTLTDGDGLLIFKPAFPQELEFYKAIQVRDVSRRKSSADGDAPLCSWMPTYLGVLNEGAKIEQSGDAALLKIDERLSDSTDNLDSIPVKSEKSKQYLVLENLLYGFSKPNILDIKLGKTLYDSKASLEKRERMKRVSETTTSGSLGFRICGMKIQKNPSVLNQLSLEYYEEEADSDYIFINKLYGRSRTDQNVSDAIELYFNNPHLSDARKHQLKKTFLKRLQLFYNTMLEEEVRMISSSLLFIYEGDPERWELLNDVDKLMRDDFIDDDDDDDDNDDDDDDDAEGSSEGPKDKKTTGSLSSMSLIDFAHSEITPGKGYDENVIEGVETLLDIFMKF | |
Gene Information
Entrez Gene ID
Gene Name
inositol polyphosphate multikinase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005634 | IDA:SGD | C | nucleus |
| GO:0005524 | IEA:UniProtKB-KW | F | ATP binding |
| GO:0000824 | IDA:SGD | F | inositol tetrakisphosphate 3-kinase activity |
| GO:0000825 | IDA:SGD | F | inositol tetrakisphosphate 6-kinase activity |
| GO:0000827 | IDA:SGD | F | inositol-1,3,4,5,6-pentakisphosphate kinase activity |
| GO:0008440 | IMP:SGD | F | inositol-1,4,5-trisphosphate 3-kinase activity |
| GO:0000823 | IDA:SGD | F | inositol-1,4,5-trisphosphate 6-kinase activity |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0035004 | IDA:SGD | F | phosphatidylinositol 3-kinase activity |
| GO:0030674 | IMP:SGD | F | protein binding, bridging |
| GO:0006525 | IEA:UniProtKB-KW | P | arginine metabolic process |
| GO:0032958 | IDA:SGD | P | inositol phosphate biosynthetic process |
| GO:0000122 | IMP:SGD | P | negative regulation of transcription from RNA polymerase II promoter |
| GO:0046854 | IDA:SGD | P | phosphatidylinositol phosphorylation |
| GO:0045944 | IMP:SGD | P | positive regulation of transcription from RNA polymerase II promoter |
| GO:0050821 | IMP:SGD | P | protein stabilization |
| GO:0000821 | IMP:SGD | P | regulation of arginine metabolic process |
| GO:0006351 | IEA:UniProtKB-KW | P | transcription, DNA-templated |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce00562 | Inositol phosphate metabolism |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005522 | Inositol polyphosphate kinase |
UniProt Annotations
Entry Information
Gene Name
inositol polyphosphate multikinase
Protein Entry
IPMK_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | 2 ATP + 1D-myo-inositol 1,4,5-trisphosphate = 2 ADP + 1D-myo-inositol 1,3,4,5,6-pentakisphosphate. |
| Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; |
| Function | Has kinase activity and phosphorylates inositol 1,4,5- trisphosphate (Ins(1,4,5)P3) and inositol 1,3,4,5- tetrakisphosphate (Ins(1,3,4,5)P4). Has low kinase activity towards InsP6. With ARG80, ARG81 and MCM1, coordinates the expression of arginine anabolic and catabolic genes in response to arginine. Recruites ARG80 and MCM21 to stabilize them. {ECO:0000269|PubMed:10574768, ECO:0000269|PubMed:10632874}. |
| Miscellaneous | Present with 2720 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Miscellaneous | The expression of this protein is not effected by the presence of arginine. |
| Similarity | Belongs to the inositol phosphokinase (IPK) family. {ECO:0000305}. |
| Subcellular Location | Nucleus {ECO:0000269|PubMed:10632874}. |
| Subunit | Interacts with ARG80 and MCM1. {ECO:0000269|PubMed:10632874, ECO:0000269|PubMed:17050532}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007262 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 398365957 | RefSeq | NP_010458 | 355 | inositol polyphosphate multikinase |
Identical Sequences to LMP007262 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:398365957 | GenBank | EDV08139.1 | 355 | inositol polyphosphate multikinase [Saccharomyces cerevisiae RM11-1a] |
| GI:398365957 | GenBank | EEU07821.1 | 355 | Arg82p [Saccharomyces cerevisiae JAY291] |
| GI:398365957 | GenBank | EGA87479.1 | 355 | Arg82p [Saccharomyces cerevisiae VL3] |
| GI:398365957 | GenBank | EWG97128.1 | 355 | Arg82p [Saccharomyces cerevisiae R103] |
| GI:398365957 | gnl | McCuskerlabDuke | 355 | Arg82p [Saccharomyces cerevisiae YJM993] |
| GI:398365957 | Third Party Genbank | DAA12015.1 | 355 | TPA: inositol polyphosphate multikinase [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007262 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:398365957 | GenBank | AAS56022.1 | 355 | YDR173C [Saccharomyces cerevisiae] |
| GI:398365957 | GenBank | EGA75457.1 | 376 | Arg82p [Saccharomyces cerevisiae AWRI796] |
| GI:398365957 | PDB | 2IEW | 363 | Chain A, Crystal Structure Of Inositol Phosphate Multikinase Ipk2 From S. Cerevisiae |
| GI:398365957 | PDB | 2IEW | 363 | Chain B, Crystal Structure Of Inositol Phosphate Multikinase Ipk2 From S. Cerevisiae |
| GI:398365957 | PDB | 2IF8 | 363 | Chain A, Crystal Structure Of Inositol Phosphate Multikinase Ipk2 In Complex With Adp And Mn2+ From S. Cerevisiae |
| GI:398365957 | PDB | 2IF8 | 363 | Chain B, Crystal Structure Of Inositol Phosphate Multikinase Ipk2 In Complex With Adp And Mn2+ From S. Cerevisiae |