Gene/Proteome Database (LMPD)

LMPD ID
LMP007266
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit CSH1
Gene Symbol
Synonyms
-
Chromosome
II
EC Number
2.-.-.-

Proteins

mannosylinositol phosphorylceramide synthase catalytic subunit CSH1
Refseq ID NP_009719
Protein GI 398365183
UniProt ID P38287
mRNA ID NM_001178509
Length 376
MKKELKILIIANIALLISIIHYTFDLLTLCIDDTSKDALTDEQLNPPNGFNSTFYESPPQLIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQPADYKMHNNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLCSGPFNNKRYYIQWLSDKFKLHKWKLTSSYKNKEKRRNPTRHEYNSRGKRLRKDSNIPYDSVFLDIEKNHAKFTDLT

Gene Information

Entrez Gene ID
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit CSH1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005773 IEA:UniProtKB-KW C vacuole
GO:0000030 IMP:SGD F mannosyltransferase activity
GO:0016757 ISS:SGD F transferase activity, transferring glycosyl groups
GO:0006688 IMP:SGD P glycosphingolipid biosynthetic process
GO:0097502 IMP:GOC P mannosylation
GO:0030148 IMP:SGD P sphingolipid biosynthetic process

BIOCYC Pathway Links

BIOCYC Pathway ID Description
SPHINGOLIPID-SYN-PWY sphingolipid biosynthesis (yeast)

Domain Information

InterPro Annotations

Accession Description
IPR007577 Glycosyltransferase, DXD sugar-binding motif
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit CSH1
Protein Entry
CSH1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide
Function Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide. {ECO:0000269|PubMed:12954640}.
Interaction P35206:CSG2; NbExp=2; IntAct=EBI-20861, EBI-2051140;
Miscellaneous Present with 195 molecules/cell in log phase SD medium
Miscellaneous Present with 195 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the glycosyltransferase 32 family
Similarity Belongs to the glycosyltransferase 32 family. {ECO:0000305}.
Subcellular Location Vacuole membrane ; Multi-pass membrane protein .
Subcellular Location Vacuole membrane {ECO:0000269|PubMed:14562095}; Multi-pass membrane protein {ECO:0000269|PubMed:14562095}.
Subunit Heterodimer of CSH1 and CSG2
Subunit Heterodimer of CSH1 and CSG2. {ECO:0000269|PubMed:12954640}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007266 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398365183 RefSeq NP_009719 376 mannosylinositol phosphorylceramide synthase catalytic subunit CSH1

Identical Sequences to LMP007266 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007266 proteins

Reference Database Accession Length Protein Name