Gene/Proteome Database (LMPD)
Proteins
| mannosylinositol phosphorylceramide synthase catalytic subunit CSH1 | |
|---|---|
| Refseq ID | NP_009719 |
| Protein GI | 398365183 |
| UniProt ID | P38287 |
| mRNA ID | NM_001178509 |
| Length | 376 |
| MKKELKILIIANIALLISIIHYTFDLLTLCIDDTSKDALTDEQLNPPNGFNSTFYESPPQLIPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLLKVPAFLRKTSPTGVSNDVMGSVPRHPFFLKVIKSLKHYKKNWYIPYMTIMGSTGPLFISVVWKQYKRWSNTAENGAVRILQPADYKMHNNSFFSISKGSSWHTGDANFMKTLENHILSCVVTGFIFGFFILYGEFTFYTWLCSGPFNNKRYYIQWLSDKFKLHKWKLTSSYKNKEKRRNPTRHEYNSRGKRLRKDSNIPYDSVFLDIEKNHAKFTDLT | |
Gene Information
Entrez Gene ID
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit CSH1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005773 | IEA:UniProtKB-KW | C | vacuole |
| GO:0000030 | IMP:SGD | F | mannosyltransferase activity |
| GO:0016757 | ISS:SGD | F | transferase activity, transferring glycosyl groups |
| GO:0006688 | IMP:SGD | P | glycosphingolipid biosynthetic process |
| GO:0097502 | IMP:GOC | P | mannosylation |
| GO:0030148 | IMP:SGD | P | sphingolipid biosynthetic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| SPHINGOLIPID-SYN-PWY | sphingolipid biosynthesis (yeast) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
mannosylinositol phosphorylceramide synthase catalytic subunit CSH1
Protein Entry
CSH1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide |
| Function | Involved in the synthesis of mannosyl phosphorylinositol ceramide. Catalyzes the addition of mannosyl to phosphorylinositol ceramide. {ECO:0000269|PubMed:12954640}. |
| Interaction | P35206:CSG2; NbExp=2; IntAct=EBI-20861, EBI-2051140; |
| Miscellaneous | Present with 195 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 195 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the glycosyltransferase 32 family |
| Similarity | Belongs to the glycosyltransferase 32 family. {ECO:0000305}. |
| Subcellular Location | Vacuole membrane ; Multi-pass membrane protein . |
| Subcellular Location | Vacuole membrane {ECO:0000269|PubMed:14562095}; Multi-pass membrane protein {ECO:0000269|PubMed:14562095}. |
| Subunit | Heterodimer of CSH1 and CSG2 |
| Subunit | Heterodimer of CSH1 and CSG2. {ECO:0000269|PubMed:12954640}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007266 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 398365183 | RefSeq | NP_009719 | 376 | mannosylinositol phosphorylceramide synthase catalytic subunit CSH1 |
Identical Sequences to LMP007266 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007266 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|