Gene/Proteome Database (LMPD)

LMPD ID
LMP007268
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Scs2p
Gene Symbol
Synonyms
-
Chromosome
V

Proteins

Scs2p
Refseq ID NP_011046
Protein GI 398364741
UniProt ID P40075
mRNA ID NM_001179010
Length 244
MSAVEISPDVLVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLVITLPSPYDLNGKAVADVWSDLEAEFKQQAISKKIKVKYLISPDVHPAQNQNIQENKETVEPVVQDSEPKEVPAVVNEKEVPAEPETQPPVQVKKEEVPPVVQKTVPHENEKQTSNSTPAPQNQIKEAATVPAENESSSMGIFILVALLILVLGWFYR

Gene Information

Entrez Gene ID
Gene Name
Scs2p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005934 IDA:SGD C cellular bud tip
GO:0005783 IDA:SGD C endoplasmic reticulum
GO:0030176 IDA:SGD C integral component of endoplasmic reticulum membrane
GO:0005635 IDA:SGD C nuclear envelope
GO:0031965 IDA:SGD C nuclear membrane
GO:0033149 IMP:SGD F FFAT motif binding
GO:0035091 IDA:SGD F phosphatidylinositol binding
GO:0005198 IEA:InterPro F structural molecule activity
GO:0006348 IMP:SGD P chromatin silencing at telomere
GO:0048309 IMP:SGD P endoplasmic reticulum inheritance
GO:0090158 IGI:SGD P endoplasmic reticulum membrane organization
GO:0061163 IDA:SGD P endoplasmic reticulum polarization
GO:0042992 IMP:SGD P negative regulation of transcription factor import into nucleus
GO:0008654 IMP:SGD P phospholipid biosynthetic process
GO:0032377 IMP:SGD P regulation of intracellular lipid transport
GO:0060304 IGI:SGD P regulation of phosphatidylinositol dephosphorylation

Domain Information

InterPro Annotations

Accession Description
IPR000535 MSP domain
IPR008962 PapD-like
IPR016763 Vesicle-associated membrane-protein-associated protein

UniProt Annotations

Entry Information

Gene Name
Scs2p
Protein Entry
SCS2_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Domain The MSP domain is required for binding to the FFAT motif of target proteins.
Function Targets proteins containing a FFAT motif to endoplasmic reticulum membranes. Regulates phospholipid biosynthesis by modulating the subcellular localization of the transcriptional repressor OPI1. {ECO:0000269|PubMed:12727870, ECO:0000269|PubMed:15668246}.
Miscellaneous Present with 3497 molecules/cell in log phase SD medium
Miscellaneous Present with 3497 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family
Similarity Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. {ECO:0000305}.
Similarity Contains 1 MSP domain. {ECO:0000255|PROSITE- ProRule:PRU00132}.
Subcellular Location Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Nucleus membrane; Single-pass type IV membrane protein.
Subunit Interacts with OPI1. {ECO:0000269|PubMed:12727870, ECO:0000269|PubMed:15455074}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007268 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
398364741 RefSeq NP_011046 244 Scs2p

Identical Sequences to LMP007268 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007268 proteins

Reference Database Accession Length Protein Name