Gene/Proteome Database (LMPD)
Proteins
Scs2p | |
---|---|
Refseq ID | NP_011046 |
Protein GI | 398364741 |
UniProt ID | P40075 |
mRNA ID | NM_001179010 |
Length | 244 |
MSAVEISPDVLVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLVITLPSPYDLNGKAVADVWSDLEAEFKQQAISKKIKVKYLISPDVHPAQNQNIQENKETVEPVVQDSEPKEVPAVVNEKEVPAEPETQPPVQVKKEEVPPVVQKTVPHENEKQTSNSTPAPQNQIKEAATVPAENESSSMGIFILVALLILVLGWFYR |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005934 | IDA:SGD | C | cellular bud tip |
GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
GO:0030176 | IDA:SGD | C | integral component of endoplasmic reticulum membrane |
GO:0005635 | IDA:SGD | C | nuclear envelope |
GO:0031965 | IDA:SGD | C | nuclear membrane |
GO:0033149 | IMP:SGD | F | FFAT motif binding |
GO:0035091 | IDA:SGD | F | phosphatidylinositol binding |
GO:0005198 | IEA:InterPro | F | structural molecule activity |
GO:0006348 | IMP:SGD | P | chromatin silencing at telomere |
GO:0048309 | IMP:SGD | P | endoplasmic reticulum inheritance |
GO:0090158 | IGI:SGD | P | endoplasmic reticulum membrane organization |
GO:0061163 | IDA:SGD | P | endoplasmic reticulum polarization |
GO:0042992 | IMP:SGD | P | negative regulation of transcription factor import into nucleus |
GO:0008654 | IMP:SGD | P | phospholipid biosynthetic process |
GO:0032377 | IMP:SGD | P | regulation of intracellular lipid transport |
GO:0060304 | IGI:SGD | P | regulation of phosphatidylinositol dephosphorylation |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | The MSP domain is required for binding to the FFAT motif of target proteins. |
Function | Targets proteins containing a FFAT motif to endoplasmic reticulum membranes. Regulates phospholipid biosynthesis by modulating the subcellular localization of the transcriptional repressor OPI1. {ECO:0000269|PubMed:12727870, ECO:0000269|PubMed:15668246}. |
Miscellaneous | Present with 3497 molecules/cell in log phase SD medium |
Miscellaneous | Present with 3497 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family |
Similarity | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. {ECO:0000305}. |
Similarity | Contains 1 MSP domain. {ECO:0000255|PROSITE- ProRule:PRU00132}. |
Subcellular Location | Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Nucleus membrane; Single-pass type IV membrane protein. |
Subunit | Interacts with OPI1. {ECO:0000269|PubMed:12727870, ECO:0000269|PubMed:15455074}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007268 (as displayed in Record Overview)
Identical Sequences to LMP007268 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007268 proteins
Reference | Database | Accession | Length | Protein Name |
---|