Gene/Proteome Database (LMPD)
Proteins
| Scs2p | |
|---|---|
| Refseq ID | NP_011046 |
| Protein GI | 398364741 |
| UniProt ID | P40075 |
| mRNA ID | NM_001179010 |
| Length | 244 |
| MSAVEISPDVLVYKSPLTEQSTEYASISNNSDQTIAFKVKTTAPKFYCVRPNAAVVAPGETIQVQVIFLGLTEEPAADFKCRDKFLVITLPSPYDLNGKAVADVWSDLEAEFKQQAISKKIKVKYLISPDVHPAQNQNIQENKETVEPVVQDSEPKEVPAVVNEKEVPAEPETQPPVQVKKEEVPPVVQKTVPHENEKQTSNSTPAPQNQIKEAATVPAENESSSMGIFILVALLILVLGWFYR | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005934 | IDA:SGD | C | cellular bud tip |
| GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
| GO:0030176 | IDA:SGD | C | integral component of endoplasmic reticulum membrane |
| GO:0005635 | IDA:SGD | C | nuclear envelope |
| GO:0031965 | IDA:SGD | C | nuclear membrane |
| GO:0033149 | IMP:SGD | F | FFAT motif binding |
| GO:0035091 | IDA:SGD | F | phosphatidylinositol binding |
| GO:0005198 | IEA:InterPro | F | structural molecule activity |
| GO:0006348 | IMP:SGD | P | chromatin silencing at telomere |
| GO:0048309 | IMP:SGD | P | endoplasmic reticulum inheritance |
| GO:0090158 | IGI:SGD | P | endoplasmic reticulum membrane organization |
| GO:0061163 | IDA:SGD | P | endoplasmic reticulum polarization |
| GO:0042992 | IMP:SGD | P | negative regulation of transcription factor import into nucleus |
| GO:0008654 | IMP:SGD | P | phospholipid biosynthetic process |
| GO:0032377 | IMP:SGD | P | regulation of intracellular lipid transport |
| GO:0060304 | IGI:SGD | P | regulation of phosphatidylinositol dephosphorylation |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Domain | The MSP domain is required for binding to the FFAT motif of target proteins. |
| Function | Targets proteins containing a FFAT motif to endoplasmic reticulum membranes. Regulates phospholipid biosynthesis by modulating the subcellular localization of the transcriptional repressor OPI1. {ECO:0000269|PubMed:12727870, ECO:0000269|PubMed:15668246}. |
| Miscellaneous | Present with 3497 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 3497 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family |
| Similarity | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. {ECO:0000305}. |
| Similarity | Contains 1 MSP domain. {ECO:0000255|PROSITE- ProRule:PRU00132}. |
| Subcellular Location | Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Nucleus membrane; Single-pass type IV membrane protein. |
| Subunit | Interacts with OPI1. {ECO:0000269|PubMed:12727870, ECO:0000269|PubMed:15455074}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007268 (as displayed in Record Overview)
Identical Sequences to LMP007268 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007268 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|