Gene/Proteome Database (LMPD)
Proteins
| Sip18p | |
|---|---|
| Refseq ID | NP_013900 |
| Protein GI | 6323829 |
| UniProt ID | P50263 |
| mRNA ID | NM_001182681 |
| Length | 79 |
| MSNMMNKFAEKLQGNDDSHQKGKNAKSSNKERDDMNMDMGMGHDQSEGGMKMGHDQSGTKMNAGRGIANDWKTYENMKK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:SGD | C | cytoplasm |
| GO:0005543 | IDA:SGD | F | phospholipid binding |
| GO:0042631 | IMP:SGD | P | cellular response to water deprivation |
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Miscellaneous | Present with 2300 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 2300 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007286 (as displayed in Record Overview)
Identical Sequences to LMP007286 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007286 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|