Gene/Proteome Database (LMPD)
Proteins
Sip18p | |
---|---|
Refseq ID | NP_013900 |
Protein GI | 6323829 |
UniProt ID | P50263 |
mRNA ID | NM_001182681 |
Length | 79 |
MSNMMNKFAEKLQGNDDSHQKGKNAKSSNKERDDMNMDMGMGHDQSEGGMKMGHDQSGTKMNAGRGIANDWKTYENMKK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:SGD | C | cytoplasm |
GO:0005543 | IDA:SGD | F | phospholipid binding |
GO:0042631 | IMP:SGD | P | cellular response to water deprivation |
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Miscellaneous | Present with 2300 molecules/cell in log phase SD medium |
Miscellaneous | Present with 2300 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007286 (as displayed in Record Overview)
Identical Sequences to LMP007286 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007286 proteins
Reference | Database | Accession | Length | Protein Name |
---|