Gene/Proteome Database (LMPD)
Proteins
| amphiphysin-like protein RVS161 | |
|---|---|
| Refseq ID | NP_009935 |
| Protein GI | 6319854 |
| UniProt ID | P25343 |
| mRNA ID | NM_001178722 |
| Length | 265 |
| MSWEGFKKAINRAGHSVIIKNVDKTIDKEYDMEERRYKVLQRAGEALQKEAKGFLDSLRAVTASQTTIAEVISNLYDDSKYVAGGGYNVGNYYLQCVQDFDSETVKQLDGPLRETVLDPITKFSTYFKEIEEAIKKRDHKKQDFDAAKAKVRRLVDKPAKDASKLPRAEKELSLAKDIFENLNNQLKTELPQLVSLRVPYFDPSFEALIKIQLRFCTDGYTRLAQIQQYLDQQSRDDYANGLLDTKIEELLGQMTSLDICALGIK | |
Gene Information
Entrez Gene ID
Gene Name
amphiphysin-like protein RVS161
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030479 | IDA:SGD | C | actin cortical patch |
| GO:0005937 | IDA:SGD | C | mating projection |
| GO:0045121 | IDA:SGD | C | membrane raft |
| GO:0008092 | IPI:SGD | F | cytoskeletal protein binding |
| GO:0051666 | IMP:SGD | P | actin cortical patch localization |
| GO:0030036 | IMP:SGD | P | actin cytoskeleton organization |
| GO:0031532 | IMP:SGD | P | actin cytoskeleton reorganization |
| GO:0000747 | IMP:SGD | P | conjugation with cellular fusion |
| GO:0006897 | IMP:SGD | P | endocytosis |
| GO:0060988 | IDA:SGD | P | lipid tube assembly |
| GO:0006970 | IMP:SGD | P | response to osmotic stress |
| GO:0042594 | IMP:SGD | P | response to starvation |
Domain Information
UniProt Annotations
Entry Information
Gene Name
amphiphysin-like protein RVS161
Protein Entry
RV161_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Function | Component of a cytoskeletal structure that is required for the formation of endocytic vesicles at the plasma membrane level. |
| Interaction | P39743:RVS167; NbExp=14; IntAct=EBI-14490, EBI-14500; |
| Miscellaneous | Mutations in this gene results in sensitivity to carbon, nitrogen and sulfur starvation. |
| Miscellaneous | Present with 7390 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 7390 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Contains 1 BAR domain. {ECO:0000255|PROSITE- ProRule:PRU00361}. |
| Subcellular Location | Cytoplasm, cytoskeleton. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007289 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6319854 | RefSeq | NP_009935 | 265 | amphiphysin-like protein RVS161 |
Identical Sequences to LMP007289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007289 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|