Gene/Proteome Database (LMPD)

LMPD ID
LMP007289
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
amphiphysin-like protein RVS161
Gene Symbol
Synonyms
END6; FUS7; SPE161
Chromosome
III

Proteins

amphiphysin-like protein RVS161
Refseq ID NP_009935
Protein GI 6319854
UniProt ID P25343
mRNA ID NM_001178722
Length 265
MSWEGFKKAINRAGHSVIIKNVDKTIDKEYDMEERRYKVLQRAGEALQKEAKGFLDSLRAVTASQTTIAEVISNLYDDSKYVAGGGYNVGNYYLQCVQDFDSETVKQLDGPLRETVLDPITKFSTYFKEIEEAIKKRDHKKQDFDAAKAKVRRLVDKPAKDASKLPRAEKELSLAKDIFENLNNQLKTELPQLVSLRVPYFDPSFEALIKIQLRFCTDGYTRLAQIQQYLDQQSRDDYANGLLDTKIEELLGQMTSLDICALGIK

Gene Information

Entrez Gene ID
Gene Name
amphiphysin-like protein RVS161
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030479 IDA:SGD C actin cortical patch
GO:0005937 IDA:SGD C mating projection
GO:0045121 IDA:SGD C membrane raft
GO:0008092 IPI:SGD F cytoskeletal protein binding
GO:0051666 IMP:SGD P actin cortical patch localization
GO:0030036 IMP:SGD P actin cytoskeleton organization
GO:0031532 IMP:SGD P actin cytoskeleton reorganization
GO:0000747 IMP:SGD P conjugation with cellular fusion
GO:0006897 IMP:SGD P endocytosis
GO:0060988 IDA:SGD P lipid tube assembly
GO:0006970 IMP:SGD P response to osmotic stress
GO:0042594 IMP:SGD P response to starvation

Domain Information

InterPro Annotations

Accession Description
IPR027267 Arfaptin homology (AH) domain/BAR domain
IPR004148 BAR domain

UniProt Annotations

Entry Information

Gene Name
amphiphysin-like protein RVS161
Protein Entry
RV161_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Function Component of a cytoskeletal structure that is required for the formation of endocytic vesicles at the plasma membrane level.
Interaction P39743:RVS167; NbExp=14; IntAct=EBI-14490, EBI-14500;
Miscellaneous Mutations in this gene results in sensitivity to carbon, nitrogen and sulfur starvation.
Miscellaneous Present with 7390 molecules/cell in log phase SD medium
Miscellaneous Present with 7390 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Contains 1 BAR domain. {ECO:0000255|PROSITE- ProRule:PRU00361}.
Subcellular Location Cytoplasm, cytoskeleton.

Identical and Related Proteins

Unique RefSeq proteins for LMP007289 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6319854 RefSeq NP_009935 265 amphiphysin-like protein RVS161

Identical Sequences to LMP007289 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007289 proteins

Reference Database Accession Length Protein Name