Gene/Proteome Database (LMPD)
Proteins
| lysophosphatidic acid acyltransferase LOA1 | |
|---|---|
| Refseq ID | NP_015465 |
| Protein GI | 6325397 |
| UniProt ID | Q06508 |
| mRNA ID | NM_001184236 |
| Length | 300 |
| MEKYTNWRDNGTGIAPFLPNTIRKPSKVMTACLLGILGVKTIIMLPLIMLYLLTGQNNLLGLILKFTFSWKEEITVQGIKKRDVRKSKHYPQKGKLYICNCTSPLDAFSVVLLAQGPVTLLVPSNDIVYKVSIREFINFILAGGLDIKLYGHEVAELSQLGNTVNFMFAEGTSCNGKSVLPFSITGKKLKEFIDPSITTMNPAMAKTKKFELQTIQIKTNKTAITTLPISNMEYLSRFLNKGINVKCKINEPQVLSDNLEELRVALNGGDKYKLVSRKLDVESKRNFVKEYISDQRKKRK | |
Gene Information
Entrez Gene ID
Gene Name
lysophosphatidic acid acyltransferase LOA1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005811 | IDA:SGD | C | lipid particle |
| GO:0003841 | IEA:UniProtKB-EC | F | 1-acylglycerol-3-phosphate O-acyltransferase activity |
| GO:0042171 | IDA:SGD | F | lysophosphatidic acid acyltransferase activity |
| GO:0035356 | IMP:SGD | P | cellular triglyceride homeostasis |
| GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
| GO:0034389 | IMP:SGD | P | lipid particle organization |
BIOCYC Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Gene Name
lysophosphatidic acid acyltransferase LOA1
Protein Entry
LOA1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate |
| Catalytic Activity | Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. {ECO:0000269|PubMed:22090344}. |
| Function | Acyl-CoA-dependent lysophosphatidic acid acyltransferase with preference for oleoyl-CoA. Involved in triacylglyceride homeostasis and lipid droplet formation. Involved in vacuolar protein sorting. {ECO:0000269|PubMed:12134085, ECO:0000269|PubMed:22090344}. |
| Miscellaneous | Present with 6630 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 6630 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family |
| Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}. |
| Subcellular Location | Lipid droplet {ECO:0000269|PubMed:21820081, ECO:0000269|PubMed:22090344}. Endoplasmic reticulum membrane {ECO:0000305}; Single-pass membrane protein . Note=Lipid droplets consist of a surface phospholipid monolayer and a hydrophobic interior. The latter makes embedding of proteins containing transmembrane segments difficult, and these may instead adopt a hairpin or monotonic conformation when associated with lipid droplet membranes. Always localizes to lipid droplets, irrespective of whether cells are grown on glucose or oleate. |
| Subcellular Location | Lipid droplet {ECO:0000269|PubMed:21820081, ECO:0000269|PubMed:22090344}. Endoplasmic reticulum membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. Note=Lipid droplets consist of a surface phospholipid monolayer and a hydrophobic interior. The latter makes embedding of proteins containing transmembrane segments difficult, and these may instead adopt a hairpin or monotonic conformation when associated with lipid droplet membranes. Always localizes to lipid droplets, irrespective of whether cells are grown on glucose or oleate. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007299 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6325397 | RefSeq | NP_015465 | 300 | lysophosphatidic acid acyltransferase LOA1 |
Identical Sequences to LMP007299 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007299 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|