Gene/Proteome Database (LMPD)

LMPD ID
LMP007299
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
lysophosphatidic acid acyltransferase LOA1
Gene Symbol
Synonyms
VPS66
Chromosome
XVI
EC Number
2.3.1.51

Proteins

lysophosphatidic acid acyltransferase LOA1
Refseq ID NP_015465
Protein GI 6325397
UniProt ID Q06508
mRNA ID NM_001184236
Length 300
MEKYTNWRDNGTGIAPFLPNTIRKPSKVMTACLLGILGVKTIIMLPLIMLYLLTGQNNLLGLILKFTFSWKEEITVQGIKKRDVRKSKHYPQKGKLYICNCTSPLDAFSVVLLAQGPVTLLVPSNDIVYKVSIREFINFILAGGLDIKLYGHEVAELSQLGNTVNFMFAEGTSCNGKSVLPFSITGKKLKEFIDPSITTMNPAMAKTKKFELQTIQIKTNKTAITTLPISNMEYLSRFLNKGINVKCKINEPQVLSDNLEELRVALNGGDKYKLVSRKLDVESKRNFVKEYISDQRKKRK

Gene Information

Entrez Gene ID
Gene Name
lysophosphatidic acid acyltransferase LOA1
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:SGD C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005811 IDA:SGD C lipid particle
GO:0003841 IEA:UniProtKB-EC F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0042171 IDA:SGD F lysophosphatidic acid acyltransferase activity
GO:0035356 IMP:SGD P cellular triglyceride homeostasis
GO:0006629 IEA:UniProtKB-KW P lipid metabolic process
GO:0034389 IMP:SGD P lipid particle organization

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-7417 phospholipid remodeling (phosphatidate)
PWY-7417 phospholipid remodeling (phosphatidate, yeast)
PWY-7411 superpathway phosphatidate biosynthesis (yeast)
PWY-7411 superpathway phosphatidate biosynthesis (yeast)

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
lysophosphatidic acid acyltransferase LOA1
Protein Entry
LOA1_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate. {ECO:0000269|PubMed:22090344}.
Function Acyl-CoA-dependent lysophosphatidic acid acyltransferase with preference for oleoyl-CoA. Involved in triacylglyceride homeostasis and lipid droplet formation. Involved in vacuolar protein sorting. {ECO:0000269|PubMed:12134085, ECO:0000269|PubMed:22090344}.
Miscellaneous Present with 6630 molecules/cell in log phase SD medium
Miscellaneous Present with 6630 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}.
Subcellular Location Lipid droplet {ECO:0000269|PubMed:21820081, ECO:0000269|PubMed:22090344}. Endoplasmic reticulum membrane {ECO:0000305}; Single-pass membrane protein . Note=Lipid droplets consist of a surface phospholipid monolayer and a hydrophobic interior. The latter makes embedding of proteins containing transmembrane segments difficult, and these may instead adopt a hairpin or monotonic conformation when associated with lipid droplet membranes. Always localizes to lipid droplets, irrespective of whether cells are grown on glucose or oleate.
Subcellular Location Lipid droplet {ECO:0000269|PubMed:21820081, ECO:0000269|PubMed:22090344}. Endoplasmic reticulum membrane {ECO:0000305}; Single-pass membrane protein {ECO:0000305}. Note=Lipid droplets consist of a surface phospholipid monolayer and a hydrophobic interior. The latter makes embedding of proteins containing transmembrane segments difficult, and these may instead adopt a hairpin or monotonic conformation when associated with lipid droplet membranes. Always localizes to lipid droplets, irrespective of whether cells are grown on glucose or oleate.

Identical and Related Proteins

Unique RefSeq proteins for LMP007299 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6325397 RefSeq NP_015465 300 lysophosphatidic acid acyltransferase LOA1

Identical Sequences to LMP007299 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007299 proteins

Reference Database Accession Length Protein Name