Gene/Proteome Database (LMPD)
Proteins
| Pil1p | |
|---|---|
| Refseq ID | NP_011600 |
| Protein GI | 398365595 |
| UniProt ID | P53252 |
| mRNA ID | NM_001181215 |
| Length | 339 |
| MHRTYSLRNSRAPTASQLQNPPPPPSTTKGRFFGKGGLAYSFRRSAAGAFGPELSRKLSQLVKIEKNVLRSMELTANERRDAAKQLSIWGLENDDDVSDITDKLGVLIYEVSELDDQFIDRYDQYRLTLKSIRDIEGSVQPSRDRKDKITDKIAYLKYKDPQSPKIEVLEQELVRAEAESLVAEAQLSNITRSKLRAAFNYQFDSIIEHSEKIALIAGYGKALLELLDDSPVTPGETRPAYDGYEASKQIIIDAESALNEWTLDSAQVKPTLSFKQDYEDFEPEEGEEEEEEDGQGRWSEDEQEDGQIEEPEQEEEGAVEEHEQVGHQQSESLPQQTTA | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0032126 | IDA:SGD | C | eisosome |
| GO:0005811 | IEA:UniProtKB-KW | C | lipid particle |
| GO:0008289 | IDA:SGD | F | lipid binding |
| GO:0070941 | IMP:SGD | P | eisosome assembly |
| GO:0006897 | IMP:SGD | P | endocytosis |
| GO:0006469 | IMP:SGD | P | negative regulation of protein kinase activity |
| GO:0008104 | IMP:SGD | P | protein localization |
| GO:0009408 | IMP:SGD | P | response to heat |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR028245 | PIL1/LSP1 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Negative regulator of cell wall integrity (CWI) in unstressed cells, probably by inhibiting protein kinase PKH1/PHK2 activity and regulating their downstream CWI pathways PKC1-MAP kinase pathway and protein kinase YPK1 pathway. Activity may be regulated by the transient increase of sphingolipid long chain bases (LCBs) during heat stress |
| Function | Negative regulator of cell wall integrity (CWI) in unstressed cells, probably by inhibiting protein kinase PKH1/PHK2 activity and regulating their downstream CWI pathways PKC1-MAP kinase pathway and protein kinase YPK1 pathway. Activity may be regulated by the transient increase of sphingolipid long chain bases (LCBs) during heat stress. {ECO:0000269|PubMed:15016821}. |
| Interaction | P35719:MRP8; NbExp=3; IntAct=EBI-23225, EBI-16255; |
| Miscellaneous | Present with 2157 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 2157 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Ptm | Phosphorylated by PKH1 and PKH2. Phosphorylation is inhibited by sphingolipid long chain bases (LCBs). {ECO:0000269|PubMed:15016821, ECO:0000269|PubMed:15665377, ECO:0000269|PubMed:17330950, ECO:0000269|PubMed:17761666, ECO:0000269|PubMed:18407956, ECO:0000269|PubMed:19779198}. |
| Subcellular Location | Lipid droplet . |
| Subcellular Location | Lipid droplet {ECO:0000269|PubMed:14562095}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007317 (as displayed in Record Overview)
Identical Sequences to LMP007317 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007317 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|