Gene/Proteome Database (LMPD)
Proteins
putative acyltransferase | |
---|---|
Refseq ID | NP_010301 |
Protein GI | 6320221 |
UniProt ID | Q12185 |
mRNA ID | NM_001180326 |
Length | 396 |
RefSeq Status | PROVISIONAL |
MKHSQKYRRYGIYEKTGNPFIKGLQRLLIACLFISGSLSIVVFQICLQVLLPWSKIRFQNGINQSKKAFIVLLCMILNMVAPSSLNVTFETSRPLKNSSNAKPCFRFKDRAIIIANHQMYADWIYLWWLSFVSNLGGNVYIILKKALQYIPLLGFGMRNFKFIFLSRNWQKDEKALTNSLVSMDLNARCKGPLTNYKSCYSKTNESIAAYNLIMFPEGTNLSLKTREKSEAFCQRAHLDHVQLRHLLLPHSKGLKFAVEKLAPSLDAIYDVTIGYSPALRTEYVGTKFTLKKIFLMGVYPEKVDFYIREFRVNEIPLQDDEVFFNWLLGVWKEKDQLLEDYYNTGQFKSNAKNDNQSIVVTTQTTGFQHETLTPRILSYYGFFAFLILVFVMKKNH |
Gene Information
Entrez Gene ID
Gene Name
putative acyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016746 | ISS:SGD | F | transferase activity, transferring acyl groups |
GO:0008654 | ISS:SGD | P | phospholipid biosynthetic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR002123 | Phospholipid/glycerol acyltransferase |
UniProt Annotations
Entry Information
Gene Name
putative acyltransferase
Protein Entry
YD018_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Domain | The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate. {ECO:0000250}. |
Similarity | Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007345 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6320221 | RefSeq | NP_010301 | 396 | putative acyltransferase |
Identical Sequences to LMP007345 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6320221 | EMBL | CAA65210.1 | 396 | orf:PZF396 [Saccharomyces cerevisiae] |
GI:6320221 | EMBL | CAA98838.1 | 396 | unnamed protein product [Saccharomyces cerevisiae] |
GI:6320221 | EMBL | CBK51087.1 | 396 | unnamed protein product [Saccharomyces cerevisiae] |
GI:6320221 | GenBank | EIW11222.1 | 396 | hypothetical protein CENPK1137D_3840 [Saccharomyces cerevisiae CEN.PK113-7D] |
GI:6320221 | SwissProt | Q12185.1 | 396 | RecName: Full=Uncharacterized acyltransferase YDR018C [Saccharomyces cerevisiae S288c] |
GI:6320221 | Third Party Genbank | DAA11864.1 | 396 | TPA: putative acyltransferase [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007345 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:6320221 | EMBL | CAY78527.1 | 403 | EC1118_1D0_2597p [Saccharomyces cerevisiae EC1118] |
GI:6320221 | GenBank | EGA75647.1 | 396 | YDR018C-like protein [Saccharomyces cerevisiae AWRI796] |
GI:6320221 | GenBank | EGA83733.1 | 403 | YDR018C-like protein [Saccharomyces cerevisiae Lalvin QA23] |
GI:6320221 | GenBank | EHN08026.1 | 403 | YDR018C-like protein [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
GI:6320221 | GenBank | EWG87079.1 | 403 | hypothetical protein R008_D11776 [Saccharomyces cerevisiae R008] |
GI:6320221 | GenBank | EWG97002.1 | 403 | hypothetical protein R103_D21751 [Saccharomyces cerevisiae R103] |