Gene/Proteome Database (LMPD)
Proteins
Inn1p | |
---|---|
Refseq ID | NP_014247 |
Protein GI | 6324177 |
UniProt ID | P53901 |
mRNA ID | NM_001182990 |
Length | 409 |
MSEEVWNGNQGILSVYVSKARDLPNLNKLDKQNVMLRLRIAHMTRASNTLHRAGQNPVFHYLEKFDITPEIKPLMYVEVYCDRRKKSPLPIGRCEIDLLNAIRADPKEGYCTWYELKRSGDEFAGTIFIELTFTPKVPRLNRDDLNKEMDRLDSSMAMRPIPPLPTESEYDYVHGSTMRQITPQCVSTSHEDKDEGQPYRNGNVFSMSSKSDTAVLANSNDPIILPPTFSASMGTTSTLETNDTAISNTSNTKFHFANLRKLKEKINIFKNPDSSTNNCQNESNKVDIEALQKAIGVTSLSYDEDDDDDDENDAFYSSSHRVSHNYNQPPLPPIPTRDDMSNYSSSRNTPLVRRDRPSRLDSSSPNSHPHPSGLNSPKLPPLPTTSNSNFNSRKNSMSPTRKRPPPRLS |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0044697 | IPI:SGD | C | HICS complex |
GO:0000142 | IDA:SGD | C | cellular bud neck contractile ring |
GO:0030234 | IGI:SGD | F | enzyme regulator activity |
GO:0005543 | ISS:SGD | F | phospholipid binding |
GO:0000917 | IMP:SGD | P | barrier septum assembly |
GO:0051276 | IMP:SGD | P | chromosome organization |
GO:0000281 | IMP:SGD | P | mitotic cytokinesis |
GO:0007067 | IEA:UniProtKB-KW | P | mitotic nuclear division |
GO:0050790 | IGI:GOC | P | regulation of catalytic activity |
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR000008 | C2 domain |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Domain | The C2 domain is essential for membrane ingression during cytokinesis, but not for recruitment to the actomyosin ring |
Domain | The C2 domain is essential for membrane ingression during cytokinesis, but not for recruitment to the actomyosin ring. {ECO:0000269|PubMed:18344988}. |
Function | Required for the ingression of the plasma membrane into the bud neck at the end of cytokinesis, leading to the separation of the mother and daughter cells. Stimulates the synthesis of the primary septum (PS) by CHS2. {ECO:0000269|PubMed:18344988, ECO:0000269|PubMed:19528296, ECO:0000269|PubMed:19707790}. |
Interaction | Q05080:HOF1; NbExp=5; IntAct=EBI-28955, EBI-5412; P80667:PEX13; NbExp=2; IntAct=EBI-28955, EBI-13206; |
Similarity | Belongs to the INN1/fic1 family |
Similarity | Belongs to the INN1/fic1 family. {ECO:0000305}. |
Similarity | Contains 1 C2 domain |
Similarity | Contains 1 C2 domain. {ECO:0000305}. |
Subcellular Location | Bud neck {ECO:0000269|PubMed:18344988, ECO:0000269|PubMed:19528296, ECO:0000269|PubMed:19707790, ECO:0000269|PubMed:20442249}. Note=Localizes at the contractile actinomyosin ring at the end of cytokinesis. Recruitment to the bud neck requires either CYK2 or CYK3. |
Subunit | Interacts with CYK2, CYK3 and IQG1. {ECO:0000269|PubMed:18344988, ECO:0000269|PubMed:19528296, ECO:0000269|PubMed:19707790}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007348 (as displayed in Record Overview)
Identical Sequences to LMP007348 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007348 proteins
Reference | Database | Accession | Length | Protein Name |
---|