Gene/Proteome Database (LMPD)
Proteins
| Srt1p | |
|---|---|
| Refseq ID | NP_013819 |
| Protein GI | 6323748 |
| UniProt ID | Q03175 |
| mRNA ID | NM_001182601 |
| Length | 343 |
| RefSeq Status | PROVISIONAL |
| MKMPSIIQIQFVALKRLLVETKEQMCFAVKSIFQRVFAWVMSLSLFSWFYVNLQNILIKALRVGPVPEHVSFIMDGNRRYAKSRRLPVKKGHEAGGLTLLTLLYICKRLGVKCVSAYAFSIENFNRPKEEVDTLMNLFTVKLDEFAKRAKDYKDPLYGSKIRIVGDQSLLSPEMRKKIKKVEEITQDGDDFTLFICFPYTSRNDMLHTIRDSVEDHLENKSPRINIRKFTNKMYMGFHSNKCELLIRTSGHRRLSDYMLWQVHENATIEFSDTLWPNFSFFAMYLMILKWSFFSTIQKYNEKNHSLFEKIHESVPSIFKKKKTAMSLYNFPNPPISVSVTGDE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005811 | IDA:SGD | C | lipid particle |
| GO:0045547 | IDA:SGD | F | dehydrodolichyl diphosphate synthase activity |
| GO:0004659 | IDA:SGD | F | prenyltransferase activity |
| GO:0006486 | IDA:SGD | P | protein glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01110 | Biosynthesis of secondary metabolites |
| ko00900 | Terpenoid backbone biosynthesis |
| sce00900 | Terpenoid backbone biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5618347 | Synthesis of Dolichyl-phosphate |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (2E,6E)-farnesyl diphosphate + n isopentenyl diphosphate = n diphosphate + ditrans,polycis-polyprenyl diphosphate (n = 10-55). {ECO:0000303|PubMed:25066056}. |
| Function | With NUS1, forms the dehydrodolichyl diphosphate syntase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precusrosor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). {ECO:0000269|PubMed:11442630, ECO:0000269|PubMed:17345630, ECO:0000269|PubMed:25066056}. |
| Induction | Expression is induced in the stationary phase. {ECO:0000269|PubMed:11442630}. |
| Pathway | Protein modification; protein glycosylation. {ECO:0000305}. |
| Similarity | Belongs to the UPP synthase family. {ECO:0000305}. |
| Subcellular Location | Lipid droplet {ECO:0000269|PubMed:11442630}. |
| Subunit | Forms an active dehydrodolichyl diphosphate syntase complex with NUS1. {ECO:0000303|PubMed:25066056}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007359 (as displayed in Record Overview)
Identical Sequences to LMP007359 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6323748 | DBBJ | GAA25542.1 | 343 | K7_Srt1p [Saccharomyces cerevisiae Kyokai no. 7] |
| GI:6323748 | EMBL | CBX84094.1 | 343 | unnamed protein product [Saccharomyces cerevisiae] |
| GI:6323748 | GenBank | AED37646.1 | 343 | Sequence 28 from patent US 7880058 |
| GI:6323748 | GenBank | EWH16709.1 | 343 | Srt1p [Saccharomyces cerevisiae P283] |
| GI:6323748 | gnl | McCuskerlabDuke | 343 | Srt1p [Saccharomyces cerevisiae YJM993] |
| GI:6323748 | Third Party Genbank | DAA09998.1 | 343 | TPA: Srt1p [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007359 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6323748 | EMBL | CAY81919.1 | 343 | Srt1p [Saccharomyces cerevisiae EC1118] |
| GI:6323748 | GenBank | EGA77568.1 | 343 | Srt1p [Saccharomyces cerevisiae Vin13] |
| GI:6323748 | GenBank | EGA81459.1 | 342 | Srt1p [Saccharomyces cerevisiae Lalvin QA23] |
| GI:6323748 | GenBank | EHN05349.1 | 343 | Srt1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
| GI:6323748 | GenBank | EIW08362.1 | 343 | Srt1p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6323748 | GenBank | EWG84023.1 | 342 | Srt1p [Saccharomyces cerevisiae R008] |