Gene/Proteome Database (LMPD)
Proteins
| dolichyl-phosphate beta-D-mannosyltransferase | |
|---|---|
| Refseq ID | NP_015509 |
| Protein GI | 6325441 |
| UniProt ID | P14020 |
| mRNA ID | NM_001184280 |
| Length | 267 |
| MSIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF | |
Gene Information
Entrez Gene ID
Gene Name
dolichyl-phosphate beta-D-mannosyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0042175 | IDA:SGD | C | nuclear outer membrane-endoplasmic reticulum membrane network |
| GO:0004582 | IDA:SGD | F | dolichyl-phosphate beta-D-mannosyltransferase activity |
| GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
| GO:0097502 | IDA:GOC | P | mannosylation |
| GO:0006487 | IMP:SGD | P | protein N-linked glycosylation |
| GO:0006493 | IMP:SGD | P | protein O-linked glycosylation |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01100 | Metabolic pathways |
| ko00510 | N-Glycan biosynthesis |
| sce00510 | N-Glycan biosynthesis |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY3O-123 | dolichyl phosphate D-mannose biosynthesis |
| MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS | dolichyl-diphosphooligosaccharide biosynthesis |
| MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS | dolichyl-diphosphooligosaccharide biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
dolichyl-phosphate beta-D-mannosyltransferase
Protein Entry
DPM1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Biophysicochemical Properties | Kinetic parameters: KM=1.2 uM for GDP-mannose {ECO:0000269|PubMed:15548536}; Vmax=25.1 nmol/min/mg enzyme for GDP-mannose {ECO:0000269|PubMed:15548536}; Note=For the phosphorylated protein, the Vmax increases to 146.7 nmol/min/mg enzyme, whereas the KM stays at 1.1 uM for GDP- mannose, increasing the catalytic efficiency 6-fold.; |
| Biophysicochemical Properties | Kinetic parameters: KM=1.2 uM for GDP-mannose ; Vmax=25.1 nmol/min/mg enzyme for GDP-mannose ; Note=For the phosphorylated protein, the Vmax increases to 146.7 nmol/min/mg enzyme, whereas the KM stays at 1.1 uM for GDP- mannose, increasing the catalytic efficiency 6-fold.; |
| Catalytic Activity | GDP-mannose + dolichyl phosphate = GDP + dolichyl D-mannosyl phosphate. |
| Function | Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O- mannosylation of proteins. |
| Miscellaneous | Present with 1885 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 1885 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Protein modification; protein glycosylation. |
| Similarity | Belongs to the glycosyltransferase 2 family |
| Similarity | Belongs to the glycosyltransferase 2 family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane ; Single-pass type IV membrane protein {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:15657391}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:15657391}; Single-pass type IV membrane protein {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:15657391}. |
| Subunit | Interacts with the C-terminus of SAC1, thereby sequestering it to the endoplasmic reticulum in exponentially growing cells. Under nutrient limitation conditions, this interaction is rapidly abolished |
| Subunit | Interacts with the C-terminus of SAC1, thereby sequestering it to the endoplasmic reticulum in exponentially growing cells. Under nutrient limitation conditions, this interaction is rapidly abolished. {ECO:0000269|PubMed:15657391}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007360 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6325441 | RefSeq | NP_015509 | 267 | dolichyl-phosphate beta-D-mannosyltransferase |
Identical Sequences to LMP007360 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007360 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|