Gene/Proteome Database (LMPD)
Proteins
dolichyl-phosphate beta-D-mannosyltransferase | |
---|---|
Refseq ID | NP_015509 |
Protein GI | 6325441 |
UniProt ID | P14020 |
mRNA ID | NM_001184280 |
Length | 267 |
MSIEYSVIVPAYHEKLNIKPLTTRLFAGMSPEMAKKTELIFVDDNSQDGSVEEVDALAHQGYNVRIIVRTNERGLSSAVLKGFYEAKGQYLVCMDADLQHPPETVPKLFESLHDHAFTLGTRYAPGVGIDKDWPMYRRVISSTARMMARPLTIASDPMSGFFGLQKKYLENCNPRDINSQGFKIALELLAKLPLPRDPRVAIGEVPFTFGVRTEGESKLSGKVIIQYLQQLKELYVFKFGANNLILFITFWSILFFYVCYQLYHLVF |
Gene Information
Entrez Gene ID
Gene Name
dolichyl-phosphate beta-D-mannosyltransferase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0042175 | IDA:SGD | C | nuclear outer membrane-endoplasmic reticulum membrane network |
GO:0004582 | IDA:SGD | F | dolichyl-phosphate beta-D-mannosyltransferase activity |
GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
GO:0097502 | IDA:GOC | P | mannosylation |
GO:0006487 | IMP:SGD | P | protein N-linked glycosylation |
GO:0006493 | IMP:SGD | P | protein O-linked glycosylation |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
sce01100 | Metabolic pathways |
ko00510 | N-Glycan biosynthesis |
sce00510 | N-Glycan biosynthesis |
BIOCYC Pathway Links
BIOCYC Pathway ID | Description |
---|---|
PWY3O-123 | dolichyl phosphate D-mannose biosynthesis |
MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS | dolichyl-diphosphooligosaccharide biosynthesis |
MANNOSYL-CHITO-DOLICHOL-BIOSYNTHESIS | dolichyl-diphosphooligosaccharide biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Gene Name
dolichyl-phosphate beta-D-mannosyltransferase
Protein Entry
DPM1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: KM=1.2 uM for GDP-mannose {ECO:0000269|PubMed:15548536}; Vmax=25.1 nmol/min/mg enzyme for GDP-mannose {ECO:0000269|PubMed:15548536}; Note=For the phosphorylated protein, the Vmax increases to 146.7 nmol/min/mg enzyme, whereas the KM stays at 1.1 uM for GDP- mannose, increasing the catalytic efficiency 6-fold.; |
Biophysicochemical Properties | Kinetic parameters: KM=1.2 uM for GDP-mannose ; Vmax=25.1 nmol/min/mg enzyme for GDP-mannose ; Note=For the phosphorylated protein, the Vmax increases to 146.7 nmol/min/mg enzyme, whereas the KM stays at 1.1 uM for GDP- mannose, increasing the catalytic efficiency 6-fold.; |
Catalytic Activity | GDP-mannose + dolichyl phosphate = GDP + dolichyl D-mannosyl phosphate. |
Function | Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O- mannosylation of proteins. |
Miscellaneous | Present with 1885 molecules/cell in log phase SD medium |
Miscellaneous | Present with 1885 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Protein modification; protein glycosylation. |
Similarity | Belongs to the glycosyltransferase 2 family |
Similarity | Belongs to the glycosyltransferase 2 family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane ; Single-pass type IV membrane protein {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:15657391}. |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:15657391}; Single-pass type IV membrane protein {ECO:0000269|PubMed:14562095, ECO:0000269|PubMed:15657391}. |
Subunit | Interacts with the C-terminus of SAC1, thereby sequestering it to the endoplasmic reticulum in exponentially growing cells. Under nutrient limitation conditions, this interaction is rapidly abolished |
Subunit | Interacts with the C-terminus of SAC1, thereby sequestering it to the endoplasmic reticulum in exponentially growing cells. Under nutrient limitation conditions, this interaction is rapidly abolished. {ECO:0000269|PubMed:15657391}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007360 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
6325441 | RefSeq | NP_015509 | 267 | dolichyl-phosphate beta-D-mannosyltransferase |
Identical Sequences to LMP007360 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007360 proteins
Reference | Database | Accession | Length | Protein Name |
---|