Gene/Proteome Database (LMPD)
Proteins
| ketoreductase | |
|---|---|
| Refseq ID | NP_009717 |
| Protein GI | 6319635 |
| UniProt ID | P38286 |
| mRNA ID | NM_001178507 |
| Length | 347 |
| MTFMQQLQEAGERFRCINGLLWVVFGLGVLKCTTLSLRFLALIFDLFLLPAVNFDKYGAKTGKYCAITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKESNYESIKELCAQLPITVLVNNVGQSHSIPVPFLETEEKELRNIITINNTATLLITQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELIISYLVTSSMSKIRRSSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPYWAHAVYQFVITETFGVYSKIVNSINYSFHKSIRIRALKKAARQVKKE | |
Gene Information
Entrez Gene ID
Gene Name
ketoreductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
| GO:0005789 | IDA:SGD | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0045703 | IMP:SGD | F | ketoreductase activity |
| GO:0030497 | IMP:SGD | P | fatty acid elongation |
| GO:0030148 | IMP:SGD | P | sphingolipid biosynthetic process |
| GO:0042761 | IMP:SGD | P | very long-chain fatty acid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| sce01110 | Biosynthesis of secondary metabolites |
| ko01040 | Biosynthesis of unsaturated fatty acids |
| sce01040 | Biosynthesis of unsaturated fatty acids |
| M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
| sce_M00415 | Fatty acid biosynthesis, elongation, endoplasmic reticulum |
| ko00062 | Fatty acid elongation |
| sce00062 | Fatty acid elongation |
| ko01212 | Fatty acid metabolism |
| sce01212 | Fatty acid metabolism |
| sce01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY-7036 | very long chain fatty acid biosynthesis II |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5618354 | Androgen biosynthesis |
| 5618114 | Fatty Acyl-CoA Biosynthesis |
| 5618090 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5618023 | Metabolism |
| 5618091 | Metabolism of lipids and lipoproteins |
| 5618355 | Metabolism of steroid hormones and vitamin D |
| 5618123 | Synthesis of very long-chain fatty acyl-CoAs |
| 5618115 | Triglyceride Biosynthesis |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + NADPH |
| Catalytic Activity | A very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + NADPH. {ECO:0000255|HAMAP-Rule:MF_03107, ECO:0000269|PubMed:12087109}. |
| Function | Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids. {ECO:0000255|HAMAP-Rule:MF_03107, ECO:0000269|PubMed:11792704, ECO:0000269|PubMed:12087109, ECO:0000269|PubMed:12684876}. |
| Miscellaneous | Present with 41900 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 41900 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000255|HAMAP-Rule:MF_03107}. |
| Subcellular Location | Endoplasmic reticulum membrane ; Single-pass membrane protein . |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000255|HAMAP-Rule:MF_03107}; Single-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_03107}. |
| Subunit | Interacts with the fatty acid elongation system components ELO3 and TSC13. {ECO:0000255|HAMAP-Rule:MF_03107, ECO:0000269|PubMed:12087109}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007373 (as displayed in Record Overview)
Identical Sequences to LMP007373 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007373 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|