Gene/Proteome Database (LMPD)

LMPD ID
LMP007373
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
ketoreductase
Gene Symbol
Synonyms
-
Chromosome
II
EC Number
1.1.1.330

Proteins

ketoreductase
Refseq ID NP_009717
Protein GI 6319635
UniProt ID P38286
mRNA ID NM_001178507
Length 347
MTFMQQLQEAGERFRCINGLLWVVFGLGVLKCTTLSLRFLALIFDLFLLPAVNFDKYGAKTGKYCAITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAIDIAEDKESNYESIKELCAQLPITVLVNNVGQSHSIPVPFLETEEKELRNIITINNTATLLITQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQGWSNSLAGELSKDAIDVELIISYLVTSSMSKIRRSSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPYWAHAVYQFVITETFGVYSKIVNSINYSFHKSIRIRALKKAARQVKKE

Gene Information

Entrez Gene ID
Gene Name
ketoreductase
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IDA:SGD C endoplasmic reticulum
GO:0005789 IDA:SGD C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0045703 IMP:SGD F ketoreductase activity
GO:0030497 IMP:SGD P fatty acid elongation
GO:0030148 IMP:SGD P sphingolipid biosynthetic process
GO:0042761 IMP:SGD P very long-chain fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
sce01110 Biosynthesis of secondary metabolites
ko01040 Biosynthesis of unsaturated fatty acids
sce01040 Biosynthesis of unsaturated fatty acids
M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
sce_M00415 Fatty acid biosynthesis, elongation, endoplasmic reticulum
ko00062 Fatty acid elongation
sce00062 Fatty acid elongation
ko01212 Fatty acid metabolism
sce01212 Fatty acid metabolism
sce01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-7036 very long chain fatty acid biosynthesis II

REACTOME Pathway Links

REACTOME Pathway ID Description
5618354 Androgen biosynthesis
5618114 Fatty Acyl-CoA Biosynthesis
5618090 Fatty acid, triacylglycerol, and ketone body metabolism
5618023 Metabolism
5618091 Metabolism of lipids and lipoproteins
5618355 Metabolism of steroid hormones and vitamin D
5618123 Synthesis of very long-chain fatty acyl-CoAs
5618115 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR027533 3_ketoreductase_fungal
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR
IPR020904 Short-chain dehydrogenase/reductase, conserved site

UniProt Annotations

Entry Information

Gene Name
ketoreductase
Protein Entry
MKAR_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity A very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + NADPH
Catalytic Activity A very-long-chain (3R)-3-hydroxyacyl-CoA + NADP(+) = a very-long-chain 3-oxoacyl-CoA + NADPH. {ECO:0000255|HAMAP-Rule:MF_03107, ECO:0000269|PubMed:12087109}.
Function Component of the microsomal membrane bound fatty acid elongation system, which produces the 26-carbon very long-chain fatty acids (VLCFA) from palmitate. Catalyzes the reduction of the 3-ketoacyl-CoA intermediate that is formed in each cycle of fatty acid elongation. VLCFAs serve as precursors for ceramide and sphingolipids. {ECO:0000255|HAMAP-Rule:MF_03107, ECO:0000269|PubMed:11792704, ECO:0000269|PubMed:12087109, ECO:0000269|PubMed:12684876}.
Miscellaneous Present with 41900 molecules/cell in log phase SD medium
Miscellaneous Present with 41900 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000255|HAMAP-Rule:MF_03107}.
Subcellular Location Endoplasmic reticulum membrane ; Single-pass membrane protein .
Subcellular Location Endoplasmic reticulum membrane {ECO:0000255|HAMAP-Rule:MF_03107}; Single-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_03107}.
Subunit Interacts with the fatty acid elongation system components ELO3 and TSC13. {ECO:0000255|HAMAP-Rule:MF_03107, ECO:0000269|PubMed:12087109}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007373 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6319635 RefSeq NP_009717 347 ketoreductase

Identical Sequences to LMP007373 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP007373 proteins

Reference Database Accession Length Protein Name