Gene/Proteome Database (LMPD)
Proteins
| Tsc3p | |
|---|---|
| Refseq ID | NP_116327 |
| Protein GI | 398364555 |
| UniProt ID | Q3E790 |
| mRNA ID | NM_001184442 |
| Length | 80 |
| MTQHKSSMVYIPTTKEAKRRNGKSEGILNTIEEVVEKLYWTYYIHLPFYLMASFDSFFLHVFFLTIFSLSFFGILKYCFL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0035339 | IDA:UniProtKB | C | SPOTS complex |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0008047 | IDA:SGD | F | enzyme activator activity |
| GO:0006666 | IPI:SGD | P | 3-keto-sphinganine metabolic process |
| GO:0043085 | IDA:GOC | P | positive regulation of catalytic activity |
| GO:0030148 | IMP:SGD | P | sphingolipid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Stimulates the activity of serine palmitoyltransferase (SPT). |
| Subcellular Location | Endoplasmic reticulum membrane ; Single-pass membrane protein {ECO:0000269|PubMed:10713067, ECO:0000269|PubMed:14562095}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:10713067, ECO:0000269|PubMed:14562095}; Single-pass membrane protein {ECO:0000269|PubMed:10713067, ECO:0000269|PubMed:14562095}. |
| Subunit | Interacts with the serine palmitoyltransferase complex LCB1-LCB2. Component of the SPOTS complex, at least composed of LCB1/2 (LCB1 and/or LCB2), ORM1/2 (ORM1 and/or ORM2), SAC1 and TSC3 |
| Subunit | Interacts with the serine palmitoyltransferase complex LCB1-LCB2. Component of the SPOTS complex, at least composed of LCB1/2 (LCB1 and/or LCB2), ORM1/2 (ORM1 and/or ORM2), SAC1 and TSC3. {ECO:0000269|PubMed:10713067, ECO:0000269|PubMed:20182505}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007383 (as displayed in Record Overview)
Identical Sequences to LMP007383 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007383 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|