Gene/Proteome Database (LMPD)
Proteins
Tfs1p | |
---|---|
Refseq ID | NP_013279 |
Protein GI | 6323207 |
UniProt ID | P14306 |
mRNA ID | NM_001182065 |
Length | 219 |
MNQAIDFAQASIDSYKKHGILEDVIHDTSFQPSGILAVEYSSSAPVAMGNTLPTEKARSKPQFQFTFNKQMQKSVPQANAYVPQDDDLFTLVMTDPDAPSKTDHKWSEFCHLVECDLKLLNEATHETSGATEFFASEFNTKGSNTLIEYMGPAPPKGSGPHRYVFLLYKQPKGVDSSKFSKIKDRPNWGYGTPATGVGKWAKENNLQLVASNFFYAETK |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IDA:SGD | C | cytoplasm |
GO:0000328 | IDA:SGD | C | fungal-type vacuole lumen |
GO:0000329 | IDA:SGD | C | fungal-type vacuole membrane |
GO:0008289 | ISS:SGD | F | lipid binding |
GO:0030414 | IDA:SGD | F | peptidase inhibitor activity |
GO:0005543 | IDA:SGD | F | phospholipid binding |
GO:0004867 | IEA:UniProtKB-KW | F | serine-type endopeptidase inhibitor activity |
GO:0030162 | IDA:SGD | P | regulation of proteolysis |
GO:0046578 | IMP:SGD | P | regulation of Ras protein signal transduction |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Specific and potent inhibitor of carboxypeptidase Y |
Function | Specific and potent inhibitor of carboxypeptidase Y. {ECO:0000269|PubMed:9521655}. |
Miscellaneous | Present with 1030 molecules/cell in log phase SD medium |
Miscellaneous | Present with 1030 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the phosphatidylethanolamine-binding protein family |
Similarity | Belongs to the phosphatidylethanolamine-binding protein family. {ECO:0000305}. |
Subcellular Location | Cytoplasm. |
Subunit | Monomer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007431 (as displayed in Record Overview)
Identical Sequences to LMP007431 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007431 proteins
Reference | Database | Accession | Length | Protein Name |
---|