Gene/Proteome Database (LMPD)
Proteins
Tax4p | |
---|---|
Refseq ID | NP_012452 |
Protein GI | 6322378 |
UniProt ID | P47030 |
mRNA ID | NM_001181516 |
Length | 604 |
MHFPKKKHSGNLSVVELPKEALQDSLTAAQITFKRYAHPNGNAGSAERPRHLKVESAPVVKSEPSLPRMRQPEPRSINHQYSRETLPGHSEAFSVPTTPLQTIHYDVRNKASNSPSSIAAAETAAYLAHTNSFSNRSSGVGSRDPVMDTETKPPRAPSALKNELQLNRMRIPPPSYDNNVRSRSISPQVSYSTSLSSSCSISSDGEETSYREKSTDEAFPPEPSMSSYSLASKASAKASLTDPSQRQQESDYTAMNKLNGGNIIYKGTLPDLIPRSQRKTSKPRFKHRLLRSPEQQQENLSRVYSDQTQNGRAIINTQQNVKLKTTMRRGKYAITDNDETFPYDRKSVSSDSDTDEDSNVMEIKDKKKKSRRSKIKKGLKTTAAVVGSSTSVLPFPHHHHHHHQLHNPNSHHLHTHHHTSSHKFNEDKPWKSHRDLGFITEQERKRYESMWVSNRYSYLRLLPWWPSLANEDDESHLQPLNLPQDGLMLNLVVKDIWYRSNLPRDLLVQIYNMVDTRKDGTLDRKSFIVGMWLVDQCLYGRKLTNELDQRVWNSVDGYVLGTINVKPATSDHYHNANNPLDKPSKLSVRQELKNIKRDLRNVRI |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0000407 | IDA:SGD | C | pre-autophagosomal structure |
GO:0005509 | IEA:InterPro | F | calcium ion binding |
GO:0006914 | IGI:SGD | P | autophagy |
GO:0009267 | IGI:SGD | P | cellular response to starvation |
GO:0031505 | IGI:SGD | P | fungal-type cell wall organization |
GO:0048017 | IGI:SGD | P | inositol lipid-mediated signaling |
GO:0006629 | IEA:UniProtKB-KW | P | lipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | With IRS4, acts as a positive regulator of INP51 activity and phosphatidylinositol 4,5-bisphosphate turnover. Negatively regulates signaling through the cell integrity pathway, including the MAP kinase SLT2 |
Function | With IRS4, acts as a positive regulator of INP51 activity and phosphatidylinositol 4,5-bisphosphate turnover. Negatively regulates signaling through the cell integrity pathway, including the MAP kinase SLT2. {ECO:0000269|PubMed:15265867}. |
Interaction | P40559:INP51; NbExp=3; IntAct=EBI-25970, EBI-24915; |
Miscellaneous | Present with 396 molecules/cell in log phase SD medium |
Miscellaneous | Present with 396 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Similarity | Belongs to the IRS4 family |
Similarity | Belongs to the IRS4 family. {ECO:0000305}. |
Similarity | Contains 1 EH domain |
Similarity | Contains 1 EH domain. {ECO:0000305}. |
Subunit | Interacts with INP51 |
Subunit | Interacts with INP51. {ECO:0000269|PubMed:15265867}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007449 (as displayed in Record Overview)
Identical Sequences to LMP007449 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007449 proteins
Reference | Database | Accession | Length | Protein Name |
---|