Gene/Proteome Database (LMPD)
Proteins
| Ssu72p | |
|---|---|
| Refseq ID | NP_014177 |
| Protein GI | 6324107 |
| UniProt ID | P53538 |
| mRNA ID | NM_001183060 |
| Length | 206 |
| RefSeq Status | PROVISIONAL |
| MPSHRNSNLKFCTVCASNNNRSMESHKVLQEAGYNVSSYGTGSAVRLPGLSIDKPNVYSFGTPYNDIYNDLLSQSADRYKSNGLLQMLDRNRRLKKAPEKWQESTKVFDFVFTCEERCFDAVCEDLMNRGGKLNKIVHVINVDIKDDDENAKIGSKAILELADMLNDKIEQCEKDDIPFEDCIMDILTEWQSSHSQLPSLYAPSYY | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005847 | IDA:SGD | C | mRNA cleavage and polyadenylation specificity factor complex |
| GO:0005634 | IGI:SGD | C | nucleus |
| GO:0008420 | IDA:SGD | F | CTD phosphatase activity |
| GO:0004721 | IGI:SGD | F | phosphoprotein phosphatase activity |
| GO:0004722 | IDA:SGD | F | protein serine/threonine phosphatase activity |
| GO:0004725 | IDA:SGD | F | protein tyrosine phosphatase activity |
| GO:0070940 | IDA:SGD | P | dephosphorylation of RNA polymerase II C-terminal domain |
| GO:0031124 | IMP:SGD | P | mRNA 3'-end processing |
| GO:0006379 | IMP:SGD | P | mRNA cleavage |
| GO:0035335 | IDA:GOC | P | peptidyl-tyrosine dephosphorylation |
| GO:0009302 | IMP:SGD | P | snoRNA transcription |
| GO:0006369 | IMP:SGD | P | termination of RNA polymerase II transcription |
| GO:0030847 | IMP:SGD | P | termination of RNA polymerase II transcription, exosome-dependent |
| GO:0030846 | IMP:SGD | P | termination of RNA polymerase II transcription, poly(A)-coupled |
| GO:0031564 | IMP:SGD | P | transcription antitermination |
| GO:0006368 | IMP:SGD | P | transcription elongation from RNA polymerase II promoter |
| GO:0006367 | IGI:SGD | P | transcription initiation from RNA polymerase II promoter |
| GO:0001174 | IMP:SGD | P | transcriptional start site selection at RNA polymerase II promoter |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR006811 | RNA polymerase II subunit A |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate. |
| Function | Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation. SSU72 is required for 3'-end formation of snoRNAs. |
| Function | Processively dephosphorylates Ser-5 of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1). |
| Similarity | Belongs to the SSU72 phosphatase family. {ECO:0000305}. |
| Subcellular Location | Nucleus {ECO:0000269|PubMed:12819204}. |
| Subunit | Component of the cleavage and polyadenylation factor (CPF) complex, which is composed of PTI1, SYC1, SSU72, GLC7, MPE1, REF2, PFS2, PTA1, YSH1/BRR5, SWD2, CFT2/YDH1, YTH1, CFT1/YHH1, FIP1 and PAP1. Component of the APT complex, which is a subcomplex of CPF, and is composed of PTI1, SYC1, SSU72, GLC7, REF2, PTA1 and SWD2. {ECO:0000269|PubMed:12819204}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007452 (as displayed in Record Overview)
Identical Sequences to LMP007452 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6324107 | GenBank | EHN05017.1 | 206 | Ssu72p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
| GI:6324107 | GenBank | EIW08230.1 | 206 | Ssu72p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6324107 | GenBank | EWG83639.1 | 206 | Ssu72p [Saccharomyces cerevisiae R008] |
| GI:6324107 | GenBank | EWG89044.1 | 206 | Ssu72p [Saccharomyces cerevisiae P301] |
| GI:6324107 | GenBank | EWG93703.1 | 206 | Ssu72p [Saccharomyces cerevisiae R103] |
| GI:6324107 | gnl | McCuskerlabDuke | 206 | Ssu72p [Saccharomyces cerevisiae YJM993] |
Related Sequences to LMP007452 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6324107 | GenBank | AAS56747.1 | 206 | YNL222W [Saccharomyces cerevisiae] |
| GI:6324107 | GenBank | EGA57137.1 | 184 | Ssu72p [Saccharomyces cerevisiae FostersB] |
| GI:6324107 | GenBank | EGA81094.1 | 184 | Ssu72p [Saccharomyces cerevisiae Lalvin QA23] |
| GI:6324107 | GenBank | EHN00588.1 | 206 | Ssu72p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7] |
| GI:6324107 | GenBank | EJS42085.1 | 206 | ssu72p [Saccharomyces arboricola H-6] |
| GI:6324107 | GenBank | EJT43195.1 | 206 | SSU72-like protein [Saccharomyces kudriavzevii IFO 1802] |