Gene/Proteome Database (LMPD)

LMPD ID
LMP007452
Gene ID
Species
Saccharomyces cerevisiae S288c (Yeast (S288c))
Gene Name
Ssu72p
Gene Symbol
Synonyms
-
Alternate Names
Ssu72p
Chromosome
XIV
EC Number
3.1.3.16

Proteins

Ssu72p
Refseq ID NP_014177
Protein GI 6324107
UniProt ID P53538
mRNA ID NM_001183060
Length 206
RefSeq Status PROVISIONAL
MPSHRNSNLKFCTVCASNNNRSMESHKVLQEAGYNVSSYGTGSAVRLPGLSIDKPNVYSFGTPYNDIYNDLLSQSADRYKSNGLLQMLDRNRRLKKAPEKWQESTKVFDFVFTCEERCFDAVCEDLMNRGGKLNKIVHVINVDIKDDDENAKIGSKAILELADMLNDKIEQCEKDDIPFEDCIMDILTEWQSSHSQLPSLYAPSYY

Gene Information

Entrez Gene ID
Gene Name
Ssu72p
Gene Symbol
Species
Saccharomyces cerevisiae S288c

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005847 IDA:SGD C mRNA cleavage and polyadenylation specificity factor complex
GO:0005634 IGI:SGD C nucleus
GO:0008420 IDA:SGD F CTD phosphatase activity
GO:0004721 IGI:SGD F phosphoprotein phosphatase activity
GO:0004722 IDA:SGD F protein serine/threonine phosphatase activity
GO:0004725 IDA:SGD F protein tyrosine phosphatase activity
GO:0070940 IDA:SGD P dephosphorylation of RNA polymerase II C-terminal domain
GO:0031124 IMP:SGD P mRNA 3'-end processing
GO:0006379 IMP:SGD P mRNA cleavage
GO:0035335 IDA:GOC P peptidyl-tyrosine dephosphorylation
GO:0009302 IMP:SGD P snoRNA transcription
GO:0006369 IMP:SGD P termination of RNA polymerase II transcription
GO:0030847 IMP:SGD P termination of RNA polymerase II transcription, exosome-dependent
GO:0030846 IMP:SGD P termination of RNA polymerase II transcription, poly(A)-coupled
GO:0031564 IMP:SGD P transcription antitermination
GO:0006368 IMP:SGD P transcription elongation from RNA polymerase II promoter
GO:0006367 IGI:SGD P transcription initiation from RNA polymerase II promoter
GO:0001174 IMP:SGD P transcriptional start site selection at RNA polymerase II promoter

KEGG Pathway Links

KEGG Pathway ID Description
ko03015 mRNA surveillance pathway
sce03015 mRNA surveillance pathway

Domain Information

InterPro Annotations

Accession Description
IPR006811 RNA polymerase II subunit A

UniProt Annotations

Entry Information

Gene Name
Ssu72p
Protein Entry
SSU72_YEAST
UniProt ID
Species
Yeast (S288c)

Comments

Comment Type Description
Catalytic Activity [a protein]-serine/threonine phosphate + H(2)O = [a protein]-serine/threonine + phosphate.
Function Component of the cleavage and polyadenylation factor (CPF) complex, which plays a key role in polyadenylation-dependent pre-mRNA 3'-end formation and cooperates with cleavage factors including the CFIA complex and NAB4/CFIB. Component of the APT complex, which may be involved in polyadenylation-independent transcript 3'-end formation. SSU72 is required for 3'-end formation of snoRNAs.
Function Processively dephosphorylates Ser-5 of the heptad repeats YSPTSPS in the C-terminal domain of the largest RNA polymerase II subunit (RPB1).
Similarity Belongs to the SSU72 phosphatase family. {ECO:0000305}.
Subcellular Location Nucleus {ECO:0000269|PubMed:12819204}.
Subunit Component of the cleavage and polyadenylation factor (CPF) complex, which is composed of PTI1, SYC1, SSU72, GLC7, MPE1, REF2, PFS2, PTA1, YSH1/BRR5, SWD2, CFT2/YDH1, YTH1, CFT1/YHH1, FIP1 and PAP1. Component of the APT complex, which is a subcomplex of CPF, and is composed of PTI1, SYC1, SSU72, GLC7, REF2, PTA1 and SWD2. {ECO:0000269|PubMed:12819204}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007452 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6324107 RefSeq NP_014177 206 Ssu72p

Identical Sequences to LMP007452 proteins

Reference Database Accession Length Protein Name
GI:6324107 GenBank EHN05017.1 206 Ssu72p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6324107 GenBank EIW08230.1 206 Ssu72p [Saccharomyces cerevisiae CEN.PK113-7D]
GI:6324107 GenBank EWG83639.1 206 Ssu72p [Saccharomyces cerevisiae R008]
GI:6324107 GenBank EWG89044.1 206 Ssu72p [Saccharomyces cerevisiae P301]
GI:6324107 GenBank EWG93703.1 206 Ssu72p [Saccharomyces cerevisiae R103]
GI:6324107 gnl McCuskerlabDuke 206 Ssu72p [Saccharomyces cerevisiae YJM993]

Related Sequences to LMP007452 proteins

Reference Database Accession Length Protein Name
GI:6324107 GenBank AAS56747.1 206 YNL222W [Saccharomyces cerevisiae]
GI:6324107 GenBank EGA57137.1 184 Ssu72p [Saccharomyces cerevisiae FostersB]
GI:6324107 GenBank EGA81094.1 184 Ssu72p [Saccharomyces cerevisiae Lalvin QA23]
GI:6324107 GenBank EHN00588.1 206 Ssu72p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
GI:6324107 GenBank EJS42085.1 206 ssu72p [Saccharomyces arboricola H-6]
GI:6324107 GenBank EJT43195.1 206 SSU72-like protein [Saccharomyces kudriavzevii IFO 1802]