Gene/Proteome Database (LMPD)
Proteins
| dodecenoyl-CoA isomerase | |
|---|---|
| Refseq ID | NP_013386 |
| Protein GI | 6323314 |
| UniProt ID | Q05871 |
| mRNA ID | NM_001182171 |
| Length | 280 |
| RefSeq Status | PROVISIONAL |
| MSQEIRQNEKISYRIEGPFFIIHLMNPDNLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGRFFSSGADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALCDIVYSINDKVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYDIMCENGFISKNFNMPSSNAEAFNAKVLEELREKVKGLYLPSCLGMKKLLKSNHIDAFNKANSVEVNESLKYWVDGEPLKRFRQLGSKQRKHRL | |
Gene Information
Entrez Gene ID
Gene Name
dodecenoyl-CoA isomerase
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005777 | IDA:SGD | C | peroxisome |
| GO:0004165 | IDA:SGD | F | dodecenoyl-CoA delta-isomerase activity |
| GO:0006635 | IDA:SGD | P | fatty acid beta-oxidation |
BIOCYC Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (3Z)-dodec-3-enoyl-CoA = (2E)-dodec-2-enoyl- CoA. |
| Function | Essential for the beta oxidation of unsaturated fatty acids. {ECO:0000269|PubMed:9837886}. |
| Induction | By oleate. {ECO:0000269|PubMed:9837886}. |
| Pathway | Lipid metabolism; fatty acid beta-oxidation. |
| Similarity | Belongs to the enoyl-CoA hydratase/isomerase family. {ECO:0000305}. |
| Subcellular Location | Peroxisome {ECO:0000269|PubMed:10381339, ECO:0000269|PubMed:11302517, ECO:0000269|PubMed:9837886}. Note=This location is DCI1 dependent. |
| Subunit | Homohexamer, dimer of trimers. Interacts with DCI1. {ECO:0000269|PubMed:10381339, ECO:0000269|PubMed:10944342, ECO:0000269|PubMed:11399063, ECO:0000269|PubMed:14741345}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007475 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6323314 | RefSeq | NP_013386 | 280 | dodecenoyl-CoA isomerase |
Identical Sequences to LMP007475 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6323314 | EMBL | CAY37256.1 | 280 | unnamed protein product [Saccharomyces cerevisiae] |
| GI:6323314 | GenBank | AAC83700.1 | 280 | d3,d2-enoyl CoA isomerase ECI1 [Saccharomyces cerevisiae] |
| GI:6323314 | GenBank | AAV20298.1 | 280 | Sequence 558 from patent US 6753314 |
| GI:6323314 | GenBank | EIW08888.1 | 280 | Eci1p [Saccharomyces cerevisiae CEN.PK113-7D] |
| GI:6323314 | SwissProt | Q05871.1 | 280 | RecName: Full=3,2-trans-enoyl-CoA isomerase; AltName: Full=Delta(3),Delta(2)-enoyl-CoA isomerase; Short=D3,D2-enoyl-CoA isomerase; AltName: Full=Dodecenoyl-CoA isomerase [Saccharomyces cerevisiae S288c] |
| GI:6323314 | Third Party Genbank | DAA09594.1 | 280 | TPA: dodecenoyl-CoA isomerase [Saccharomyces cerevisiae S288c] |
Related Sequences to LMP007475 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6323314 | GenBank | EDN59369.1 | 280 | delta3,delta2-enoyl-CoA isomerase [Saccharomyces cerevisiae YJM789] |
| GI:6323314 | GenBank | EGA77607.1 | 280 | Eci1p [Saccharomyces cerevisiae Vin13] |
| GI:6323314 | GenBank | EGA85682.1 | 280 | Eci1p [Saccharomyces cerevisiae VL3] |
| GI:6323314 | gnl | McCuskerlabDuke | 280 | Eci1p [Saccharomyces cerevisiae YJM993] |
| GI:6323314 | PDB | 1PJH | 280 | Chain A, Structural Studies On Delta3-Delta2-Enoyl-Coa Isomerase: The Variable Mode Of Assembly Of The Trimeric Disks Of The Crotonase Superfamily |
| GI:6323314 | PDB | 1PJH | 280 | Chain B, Structural Studies On Delta3-Delta2-Enoyl-Coa Isomerase: The Variable Mode Of Assembly Of The Trimeric Disks Of The Crotonase Superfamily |