Gene/Proteome Database (LMPD)
Proteins
| Pbn1p | |
|---|---|
| Refseq ID | NP_009878 |
| Protein GI | 6319797 |
| UniProt ID | P25580 |
| mRNA ID | NM_001178697 |
| Length | 416 |
| MVTRHRVTVLYNAPEDIGNHMRQNDTHLTVRGGSGVVLQQRWLLERTGSLDKSFTRITWRPRADLARSLSVIENELSAGFSVYSNSSDVPERFITNPVYNSFHSEKFDIEQYLPPEVDLNLSWNPEDFTYDISVEPTQIQIVEYRLLKQGEEFTIARVKDEKLEVGVFFVDASDESDVDIGGIRCNWRMDDGKMERCQKTSLLYKQGHIAYNHSTTTTSLYLNEPIGLHPKIMIDLTDFEERPKCMYLMHLQLPLELFIDKFQSSPLLLFGEDDLELPEYSLRDKAWGSESIFELKAGTMNEVTLHTRYIEPSNNKGDKLEVSFDPEVILACDTGDNKVSRNPFYKKGLGYESLFTDDTTFRHLNSTTLLVPIPRPDTKDYSKIKNGTLLCLLISIIYIFSKVFGNNKKKRSVKRE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
| GO:0005789 | IEA:InterPro | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0030433 | IMP:SGD | P | ER-associated ubiquitin-dependent protein catabolic process |
| GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
| GO:0097502 | IMP:GOC | P | mannosylation |
| GO:0016485 | IMP:SGD | P | protein processing |
KEGG Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR013233 | Glycosylphosphatidylinositol-mannosyltransferase I, PIG-X/PBN1 |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Required for proper folding and/or the stability of a subset of proteins in the endoplasmic reticulum. Aids the autocatalytic processing of PRB1. Component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase GPI14. {ECO:0000269|PubMed:15635094, ECO:0000269|PubMed:16418276, ECO:0000269|PubMed:9649520}. |
| Miscellaneous | Present with 4930 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 4930 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
| Ptm | N-glycosylated |
| Ptm | N-glycosylated. {ECO:0000269|PubMed:9649520}. |
| Similarity | Belongs to the PIGX family |
| Similarity | Belongs to the PIGX family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane ; Single-pass type III membrane protein . |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:9649520}; Single-pass type III membrane protein {ECO:0000269|PubMed:9649520}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007506 (as displayed in Record Overview)
Identical Sequences to LMP007506 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007506 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|