Gene/Proteome Database (LMPD)
Proteins
Pbn1p | |
---|---|
Refseq ID | NP_009878 |
Protein GI | 6319797 |
UniProt ID | P25580 |
mRNA ID | NM_001178697 |
Length | 416 |
MVTRHRVTVLYNAPEDIGNHMRQNDTHLTVRGGSGVVLQQRWLLERTGSLDKSFTRITWRPRADLARSLSVIENELSAGFSVYSNSSDVPERFITNPVYNSFHSEKFDIEQYLPPEVDLNLSWNPEDFTYDISVEPTQIQIVEYRLLKQGEEFTIARVKDEKLEVGVFFVDASDESDVDIGGIRCNWRMDDGKMERCQKTSLLYKQGHIAYNHSTTTTSLYLNEPIGLHPKIMIDLTDFEERPKCMYLMHLQLPLELFIDKFQSSPLLLFGEDDLELPEYSLRDKAWGSESIFELKAGTMNEVTLHTRYIEPSNNKGDKLEVSFDPEVILACDTGDNKVSRNPFYKKGLGYESLFTDDTTFRHLNSTTLLVPIPRPDTKDYSKIKNGTLLCLLISIIYIFSKVFGNNKKKRSVKRE |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005783 | IDA:SGD | C | endoplasmic reticulum |
GO:0005789 | IEA:InterPro | C | endoplasmic reticulum membrane |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0030433 | IMP:SGD | P | ER-associated ubiquitin-dependent protein catabolic process |
GO:0006506 | IMP:SGD | P | GPI anchor biosynthetic process |
GO:0097502 | IMP:GOC | P | mannosylation |
GO:0016485 | IMP:SGD | P | protein processing |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR013233 | Glycosylphosphatidylinositol-mannosyltransferase I, PIG-X/PBN1 |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Required for proper folding and/or the stability of a subset of proteins in the endoplasmic reticulum. Aids the autocatalytic processing of PRB1. Component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase GPI14. {ECO:0000269|PubMed:15635094, ECO:0000269|PubMed:16418276, ECO:0000269|PubMed:9649520}. |
Miscellaneous | Present with 4930 molecules/cell in log phase SD medium |
Miscellaneous | Present with 4930 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
Pathway | Glycolipid biosynthesis; glycosylphosphatidylinositol- anchor biosynthesis. |
Ptm | N-glycosylated |
Ptm | N-glycosylated. {ECO:0000269|PubMed:9649520}. |
Similarity | Belongs to the PIGX family |
Similarity | Belongs to the PIGX family. {ECO:0000305}. |
Subcellular Location | Endoplasmic reticulum membrane ; Single-pass type III membrane protein . |
Subcellular Location | Endoplasmic reticulum membrane {ECO:0000269|PubMed:9649520}; Single-pass type III membrane protein {ECO:0000269|PubMed:9649520}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007506 (as displayed in Record Overview)
Identical Sequences to LMP007506 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007506 proteins
Reference | Database | Accession | Length | Protein Name |
---|