Gene/Proteome Database (LMPD)
Proteins
| phosphatidate phosphatase LPP1 | |
|---|---|
| Refseq ID | NP_010791 |
| Protein GI | 398366657 |
| UniProt ID | Q04396 |
| mRNA ID | NM_001180811 |
| Length | 274 |
| MISVMADEKHKEYFKLYYFQYMIIGLCTILFLYSEISLVPRGQNIEFSLDDPSISKRYVPNELVGPLECLILSVGLSNMVVFWTCMFDKDLLKKNRVKRLRERPDGISNDFHFMHTSILCLMLIISINAALTGALKLIIGNLRPDFVDRCIPDLQKMSDSDSLVFGLDICKQTNKWILYEGLKSTPSGHSSFIVSTMGFTYLWQRVFTTRNTRSCIWCPLLALVVMVSRVIDHRHHWYDVVSGAVLAFLVIYCCWKWTFTNLAKRDILPSPVSV | |
Gene Information
Entrez Gene ID
Gene Name
phosphatidate phosphatase LPP1
Gene Symbol
Species
Saccharomyces cerevisiae S288c
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016020 | IDA:SGD | C | membrane |
| GO:0008195 | IDA:SGD | F | phosphatidate phosphatase activity |
| GO:0016311 | IDA:GOC | P | dephosphorylation |
| GO:0006644 | IMP:SGD | P | phospholipid metabolic process |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| TRIGLSYN-PWY | triacylglycerol biosynthesis |
| TRIGLSYN-PWY | triacylglycerol biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000326 | Phosphatidic acid phosphatase type 2/haloperoxidase |
UniProt Annotations
Entry Information
Gene Name
phosphatidate phosphatase LPP1
Protein Entry
LPP1_YEAST
UniProt ID
Species
Yeast (S288c)
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate |
| Catalytic Activity | A 1,2-diacylglycerol 3-phosphate + H(2)O = a 1,2-diacyl-sn-glycerol + phosphate. {ECO:0000269|PubMed:9603941}. |
| Catalytic Activity | Diacylglycerol pyrophosphate + H(2)O = phosphatidate + phosphate |
| Catalytic Activity | Diacylglycerol pyrophosphate + H(2)O = phosphatidate + phosphate. {ECO:0000269|PubMed:9603941}. |
| Domain | The phosphatase sequence motif I (including Arg-143) and II (including His-189) are part of the cytoplasmic loop 2 and phosphatase sequence motif III (including His-235) is part of the cytoplasmic loop 3. |
| Enzyme Regulation | PA phosphatase activity is magnesium ion- independent and potently inhibited by N-ethylmaleimide. Also inhibited by phenylglyoxal and propranolol |
| Enzyme Regulation | PA phosphatase activity is magnesium ion- independent and potently inhibited by N-ethylmaleimide. Also inhibited by phenylglyoxal and propranolol. {ECO:0000269|PubMed:10685032}. |
| Function | Catalyzes the dephosphorylation of diacylglycerol phosphate (DGPP) to phosphatidate (PA) and the subsequent dephosphorylation of PA to diacylglycerol (DAG). Together with DPP1, regulates intracellular DGPP and PA levels which are phospholipid molecules believed to play a signaling role in stress response. Can also use lysophosphatidic acid (LPA) as a substrate. Substrate preference is PA > DGPP > LPA |
| Function | Catalyzes the dephosphorylation of diacylglycerol phosphate (DGPP) to phosphatidate (PA) and the subsequent dephosphorylation of PA to diacylglycerol (DAG). Together with DPP1, regulates intracellular DGPP and PA levels which are phospholipid molecules believed to play a signaling role in stress response. Can also use lysophosphatidic acid (LPA) as a substrate. Substrate preference is PA > DGPP > LPA. {ECO:0000269|PubMed:10685032, ECO:0000269|PubMed:9603941}. |
| Miscellaneous | Present with 300 molecules/cell in log phase SD medium |
| Miscellaneous | Present with 300 molecules/cell in log phase SD medium. {ECO:0000269|PubMed:14562106}. |
| Similarity | Belongs to the PA-phosphatase related phosphoesterase family |
| Similarity | Belongs to the PA-phosphatase related phosphoesterase family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane ; Multi-pass membrane protein . |
| Subcellular Location | Golgi apparatus membrane {ECO:0000269|PubMed:14562095}; Multi-pass membrane protein {ECO:0000269|PubMed:14562095}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007525 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 398366657 | RefSeq | NP_010791 | 274 | phosphatidate phosphatase LPP1 |
Identical Sequences to LMP007525 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007525 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|