Gene/Proteome Database (LMPD)

LMPD ID
LMP007547
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
O-antigen polymerase
Gene Symbol
Synonyms
ECK2029; JW2020; rfc; yefF
Summary
Lipopolysaccharide (LPS) is a major component of the outer membrane in most gram-negative bacteria. [More information is available at EcoCyc: EG11982].
Orthologs

Proteins

O-antigen polymerase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_416539
Protein GI 16129975
UniProt ID P37748
Length 388
RefSeq Status REVIEWED
MIYLVISVFLITAFICLYLKKDIFYPAVCVNIIFALVLLGYEITSDIYAFQLNDATLIFLLCNVLTFTLSCLLTESVLDLNIRKVNNAIYSIPSKKVHNVGLLVISFSMIYICMRLSNYQFGTSLLSYMNLIRDADVEDTSRNFSAYMQPIILTTFALFIWSKKFTNTKVSKTFTLLVFIVFIFAIILNTGKQIVFMVIISYAFIVGVNRVKHYVYLITAVGVLFSLYMLFLRGLPGGMAYYLSMYLVSPIIAFQEFYFQQVSNSASSHVFWFFERLMGLLTGGVSMSLHKEFVWVGLPTNVYTAFSDYVYISAELSYLMMVIHGCISGVLWRLSRNYISVKIFYSYFIYTFSFIFYHESFMTNISSWIQITLCIIVFSQFLKAQKIK

Gene Information

Entrez Gene ID
Gene Name
O-antigen polymerase
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0009103 IEA:UniProtKB-UniPathway P lipopolysaccharide biosynthetic process

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
O-antigen polymerase
Protein Entry
RFC_ECOLI
UniProt ID
Species
E. coli

Comments

Comment Type Description
Function May link the O-antigen tetrasaccharide units into long chains, giving rise to typical smooth LPS.
Pathway Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis.
Subcellular Location Cell inner membrane {ECO:0000269|PubMed:15919996}; Multi-pass membrane protein {ECO:0000269|PubMed:15919996}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007547 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16129975 RefSeq NP_416539 388 O-antigen polymerase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007547 proteins

Reference Database Accession Length Protein Name
GI:16129975 EMBL CDY59323.1 388 O-antigen polymerase [Escherichia coli]
GI:16129975 EMBL CDZ20856.1 388 O-antigen polymerase [Escherichia coli]
GI:16129975 GenBank KGA85580.1 388 polymerase [Escherichia coli]
GI:16129975 GenBank KGL67751.1 388 O-antigen polymerase [Escherichia coli NCTC 50110]
GI:16129975 gnl PRJNA257976 388 O-antigen polymerase [Escherichia coli BW25113]
GI:16129975 gnl IGS 388 O-antigen polymerase [Escherichia coli ER2796]

Related Sequences to LMP007547 proteins

Reference Database Accession Length Protein Name
GI:16129975 GenBank EQS64946.1 388 O-antigen polymerase [Escherichia coli HVH 158 (4-3224287)]
GI:16129975 GenBank EQT24339.1 388 O-antigen polymerase [Escherichia coli HVH 175 (4-3405184)]
GI:16129975 GenBank EQT45206.1 388 O-antigen polymerase [Escherichia coli HVH 184 (4-3343286)]
GI:16129975 RefSeq WP_021535848.1 388 O-antigen polymerase [Escherichia coli]
GI:16129975 RefSeq WP_021538054.1 388 O-antigen polymerase [Escherichia coli]
GI:16129975 RefSeq WP_032242435.1 388 polymerase [Escherichia coli]