Gene/Proteome Database (LMPD)
LMPD ID
LMP007547
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
O-antigen polymerase
Gene Symbol
Synonyms
ECK2029; JW2020; rfc; yefF
Summary
Lipopolysaccharide (LPS) is a major component of the outer membrane in most gram-negative bacteria. [More information is available at EcoCyc: EG11982].
Orthologs
Proteins
| O-antigen polymerase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_416539 |
| Protein GI | 16129975 |
| UniProt ID | P37748 |
| Length | 388 |
| RefSeq Status | REVIEWED |
| MIYLVISVFLITAFICLYLKKDIFYPAVCVNIIFALVLLGYEITSDIYAFQLNDATLIFLLCNVLTFTLSCLLTESVLDLNIRKVNNAIYSIPSKKVHNVGLLVISFSMIYICMRLSNYQFGTSLLSYMNLIRDADVEDTSRNFSAYMQPIILTTFALFIWSKKFTNTKVSKTFTLLVFIVFIFAIILNTGKQIVFMVIISYAFIVGVNRVKHYVYLITAVGVLFSLYMLFLRGLPGGMAYYLSMYLVSPIIAFQEFYFQQVSNSASSHVFWFFERLMGLLTGGVSMSLHKEFVWVGLPTNVYTAFSDYVYISAELSYLMMVIHGCISGVLWRLSRNYISVKIFYSYFIYTFSFIFYHESFMTNISSWIQITLCIIVFSQFLKAQKIK | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0009103 | IEA:UniProtKB-UniPathway | P | lipopolysaccharide biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | May link the O-antigen tetrasaccharide units into long chains, giving rise to typical smooth LPS. |
| Pathway | Bacterial outer membrane biogenesis; lipopolysaccharide biosynthesis. |
| Subcellular Location | Cell inner membrane {ECO:0000269|PubMed:15919996}; Multi-pass membrane protein {ECO:0000269|PubMed:15919996}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007547 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16129975 | RefSeq | NP_416539 | 388 | O-antigen polymerase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007547 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129975 | EMBL | CDY59323.1 | 388 | O-antigen polymerase [Escherichia coli] |
| GI:16129975 | EMBL | CDZ20856.1 | 388 | O-antigen polymerase [Escherichia coli] |
| GI:16129975 | GenBank | KGA85580.1 | 388 | polymerase [Escherichia coli] |
| GI:16129975 | GenBank | KGL67751.1 | 388 | O-antigen polymerase [Escherichia coli NCTC 50110] |
| GI:16129975 | gnl | PRJNA257976 | 388 | O-antigen polymerase [Escherichia coli BW25113] |
| GI:16129975 | gnl | IGS | 388 | O-antigen polymerase [Escherichia coli ER2796] |
Related Sequences to LMP007547 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129975 | GenBank | EQS64946.1 | 388 | O-antigen polymerase [Escherichia coli HVH 158 (4-3224287)] |
| GI:16129975 | GenBank | EQT24339.1 | 388 | O-antigen polymerase [Escherichia coli HVH 175 (4-3405184)] |
| GI:16129975 | GenBank | EQT45206.1 | 388 | O-antigen polymerase [Escherichia coli HVH 184 (4-3343286)] |
| GI:16129975 | RefSeq | WP_021535848.1 | 388 | O-antigen polymerase [Escherichia coli] |
| GI:16129975 | RefSeq | WP_021538054.1 | 388 | O-antigen polymerase [Escherichia coli] |
| GI:16129975 | RefSeq | WP_032242435.1 | 388 | polymerase [Escherichia coli] |