Gene/Proteome Database (LMPD)

LMPD ID
LMP007560
Gene ID
948545
Species
Escherichia coli K-12 (E. coli)
Gene Name
chorismate--pyruvate lyase
Gene Symbol
ubiC
Synonyms
ECK4031; JW5713; sdgG?
Summary
Chorismate pyruvate lyase catalyzes the first committed step in the biosynthesis of ubiquinone, the conversion of chorismate to 4-hydroxybenzoate . [More information is available at EcoCyc: EG11369].
Orthologs
View orthologs and multiple alignments for ubiC

Proteins

chorismate--pyruvate lyase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_418463
Protein GI 90111677
UniProt ID P26602
Length 165
RefSeq Status REVIEWED
MSHPALTQLRALRYCKEIPALDPQLLDWLLLEDSMTKRFEQQGKTVSVTMIREGFVEQNEIPEELPLLPKESRYWLREILLCADGEPWLAGRTVVPVSTLSGPELALQKLGKTPLGRYLFTSSTLTRDFIEIGRDAGLWGRRSRLRLSGKPLLLTELFLPASPLY

Gene Information

Entrez Gene ID
948545
Gene Name
chorismate--pyruvate lyase
Gene Symbol
ubiC
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005829 IDA:EcoCyc C cytosol
GO:0008813 IDA:EcoCyc F chorismate lyase activity
GO:0042866 IEA:UniProtKB-HAMAP P pyruvate biosynthetic process
GO:0006744 IMP:EcoCyc P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco01110 Biosynthesis of secondary metabolites
eco01100 Metabolic pathways
eco00130 Ubiquinone and other terpenoid-quinone biosynthesis
ko00130 Ubiquinone and other terpenoid-quinone biosynthesis
M00117 Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
eco_M00117 Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-5755 4-hydroxybenzoate biosynthesis II (bacteria and fungi)
PWY-5755 4-hydroxybenzoate biosynthesis II (bacteria and fungi)
PWY-5755 4-hydroxybenzoate biosynthesis II (bacteria and fungi)
ALL-CHORISMATE-PWY superpathway of chorismate metabolism
ALL-CHORISMATE-PWY superpathway of chorismate metabolism
UBISYN-PWY superpathway of ubiquinol-8 biosynthesis (prokaryotic)
UBISYN-PWY superpathway of ubiquinol-8 biosynthesis (prokaryotic)
UBISYN-PWY ubiquinol-8 biosynthesis (prokaryotic)

Domain Information

InterPro Annotations

Accession Description
IPR007440 Chorismate--pyruvate_lyase
IPR028978 Chorismate_lyase_/UTRA_dom

UniProt Annotations

Entry Information

Gene Name
chorismate--pyruvate lyase
Protein Entry
UBIC_ECOLI
UniProt ID
P26602
Species
E. coli

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=29 uM for chorismate {ECO:0000269|PubMed:11825618}; pH dependence: Optimum pH is 7.5. {ECO:0000269|PubMed:11825618};
Catalytic Activity Chorismate = 4-hydroxybenzoate + pyruvate.
Enzyme Regulation Inhibited by 4-hydroxybenzoate, vanillate, 4- hydroxybenzaldehyde and 3-carboxymethylaminomethyl-4- hydroxybenzoic acid. {ECO:0000269|PubMed:11825618, ECO:0000269|PubMed:16343413}.
Function Removes the pyruvyl group from chorismate, with concomitant aromatization of the ring, to provide 4- hydroxybenzoate (4HB) for the ubiquinone pathway.
Interaction P0AFG8:aceE; NbExp=1; IntAct=EBI-559360, EBI-542683;
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Sequence Caution Sequence=AAC43133.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305}; Sequence=CAA40681.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Similarity Belongs to the UbiC family. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Monomer. {ECO:0000269|PubMed:11455603}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007560 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111677 RefSeq NP_418463 165 chorismate--pyruvate lyase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007560 proteins

Reference Database Accession Length Protein Name
GI:90111677 GenBank KHH88217.1 165 chorismate--pyruvate lyase [Escherichia coli]
GI:90111677 GenBank KHH88351.1 165 chorismate--pyruvate lyase [Escherichia coli]
GI:90111677 GenBank KHI12356.1 165 chorismate--pyruvate lyase [Escherichia coli]
GI:90111677 GenBank KHI16624.1 165 chorismate--pyruvate lyase [Escherichia coli]
GI:90111677 GenBank KHI62943.1 165 chorismate--pyruvate lyase [Escherichia coli]
GI:90111677 gnl IGS 165 chorismate--pyruvate lyase [Escherichia coli ER2796]

Related Sequences to LMP007560 proteins

Reference Database Accession Length Protein Name
GI:90111677 EMBL CAA40681.1 202 4-hydroxybenzoate synthetase [Escherichia coli str. K-12 substr. W3110]
GI:90111677 GenBank AAC43133.1 202 chorismate lyase [Escherichia coli str. K-12 substr. MG1655]
GI:90111677 GenBank AAS32271.1 227 Sequence 8 from patent US 6683231
GI:90111677 GenBank ABL31889.1 227 Sequence 42 from patent US 7135326
GI:90111677 GenBank EGI07992.1 202 chorismate lyase [Escherichia coli H736]
GI:90111677 GenBank EIG72744.1 202 chorismate-pyruvate lyase [Escherichia sp. 4_1_40B]