Gene/Proteome Database (LMPD)

LMPD ID
LMP007568
Gene ID
947953
Species
Escherichia coli K-12 (E. coli)
Gene Name
sn-glycerol-3-phosphate ABC transporter ATPase
Gene Symbol
ugpC
Synonyms
ECK3434; JW3415
Summary
Pho regulon. [More information is available at EcoGene: EG11048]. The UgpABCE glycerol-3-phosphate uptake system is a member of the ATP-Binding Cassette (ABC) Superfamily . [More information is available at EcoCyc: EG11048].
Orthologs
View orthologs and multiple alignments for ugpC

Proteins

sn-glycerol-3-phosphate ABC transporter ATPase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417907
Protein GI 90111593
UniProt ID P10907
Length 356
RefSeq Status REVIEWED
MAGLKLQAVTKSWDGKTQVIKPLTLDVADGEFIVMVGPSGCGKSTLLRMVAGLERVTEGDIWINDQRVTEMEPKDRGIAMVFQNYALYPHMSVEENMAWGLKIRGMGKQQIAERVKEAARILELDGLLKRRPRELSGGQRQRVAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRLELQQLHRRLKTTSLYVTHDQVEAMTLAQRVMVMNGGVAEQIGTPVEVYEKPASLFVASFIGSPAMNLLTGRVNNEGTHFELDGGIELPLNGGYRQYAGRKMTLGIRPEHIALSSQAEGGVPMVMDTLEILGADNLAHGRWGEQKLVVRLAHQERPTAGSTLWLHLAENQLHLFDGETGQRV

Gene Information

Entrez Gene ID
947953
Gene Name
sn-glycerol-3-phosphate ABC transporter ATPase
Gene Symbol
ugpC
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0055052 IDA:EcoCyc C ATP-binding cassette (ABC) transporter complex, substrate-binding subunit-containing
GO:0005524 IEA:UniProtKB-HAMAP F ATP binding
GO:0015430 IEA:UniProtKB-HAMAP F glycerol-3-phosphate-transporting ATPase activity
GO:0008643 IEA:UniProtKB-KW P carbohydrate transport
GO:0015794 IDA:EcoCyc P glycerol-3-phosphate transport
GO:0001407 IDA:EcoCyc P glycerophosphodiester transport

KEGG Pathway Links

KEGG Pathway ID Description
eco02010 ABC transporters
ko02010 ABC transporters
M00198 Putative sn-glycerol-phosphate transport system
eco_M00198 Putative sn-glycerol-phosphate transport system

Domain Information

InterPro Annotations

Accession Description
IPR003593 AAA+ ATPase domain
IPR017871 ABC transporter, conserved site
IPR017922 ABC_G3P_import_ATP-bd
IPR003439 ABC_transporter-like
IPR008995 Mo/tungstate-bd_C_term_dom
IPR012340 Nucleic acid-binding, OB-fold
IPR027417 P-loop containing nucleoside triphosphate hydrolase
IPR013611 Transp-assoc_OB_typ2

UniProt Annotations

Entry Information

Gene Name
sn-glycerol-3-phosphate ABC transporter ATPase
Protein Entry
UGPC_ECOLI
UniProt ID
P10907
Species
E. coli

Comments

Comment Type Description
Catalytic Activity ATP + H(2)O + glycerol-3-phosphate(Out) = ADP + phosphate + glycerol-3-phosphate(In). {ECO:0000255|HAMAP- Rule:MF_01727}.
Enzyme Regulation Activated by gluconate, inhibited by fumarate and internal phosphate. Internal phosphate may bind to UgpC and reduce its affinity for UgpA and UgpE. {ECO:0000269|PubMed:363686}.
Function Part of the ABC transporter complex UgpABCE involved in sn-glycerol-3-phosphate import. Responsible for energy coupling to the transport system (Probable). Can also transport glycerophosphoryl diesters. {ECO:0000255|HAMAP-Rule:MF_01727, ECO:0000269|PubMed:2842304, ECO:0000269|PubMed:363686, ECO:0000269|PubMed:7042685, ECO:0000269|PubMed:8282692, ECO:0000269|PubMed:8407831, ECO:0000305}.
Induction Induced by phosphate starvation, via PhoB. Also induced by carbon starvation, via the cAMP receptor protein (CRP). {ECO:0000269|PubMed:1987150, ECO:0000269|PubMed:2842304, ECO:0000269|PubMed:7042685}.
Miscellaneous Functional exchangeability of MalK and UgpC. But UgpC does not complement the regulatory function of MalK.
Sequence Caution Sequence=AAB18425.1; Type=Erroneous initiation; Note=Translation N-terminally shortened.; Evidence={ECO:0000305};
Similarity Belongs to the ABC transporter superfamily. sn- glycerol-3-phosphate importer (TC 3.A.1.1.3) family. {ECO:0000255|HAMAP-Rule:MF_01727}.
Similarity Contains 1 ABC transporter domain. {ECO:0000255|HAMAP- Rule:MF_01727}.
Subcellular Location Cell inner membrane; Peripheral membrane protein.
Subunit The complex is composed of two ATP-binding proteins (UgpC), two transmembrane proteins (UgpA and UgpE) and a solute- binding protein (UgpB). {ECO:0000255|HAMAP-Rule:MF_01727}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007568 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
90111593 RefSeq NP_417907 356 sn-glycerol-3-phosphate ABC transporter ATPase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007568 proteins

Reference Database Accession Length Protein Name
GI:90111593 GenBank KHH91803.1 356 glycerol-3-phosphate transporter ATP-binding subunit [Escherichia coli]
GI:90111593 GenBank KHI19144.1 356 glycerol-3-phosphate transporter ATP-binding subunit [Escherichia coli]
GI:90111593 GenBank KHI22185.1 356 glycerol-3-phosphate transporter ATP-binding subunit [Escherichia coli]
GI:90111593 GenBank KHI60292.1 356 glycerol-3-phosphate transporter ATP-binding subunit [Escherichia coli]
GI:90111593 GenBank KHI75773.1 356 glycerol-3-phosphate transporter ATP-binding subunit [Escherichia coli]
GI:90111593 gnl IGS 356 glycerol-3-phosphate transporter subunit [Escherichia coli ER2796]

Related Sequences to LMP007568 proteins

Reference Database Accession Length Protein Name
GI:90111593 EMBL CBF83511.1 369 unnamed protein product [Escherichia coli K-12]
GI:90111593 EMBL CBG15067.1 369 unnamed protein product [Escherichia coli K-12]
GI:90111593 EMBL CBV28513.1 369 unnamed protein product [Escherichia coli K-12]
GI:90111593 EMBL CBV00863.1 369 unnamed protein product [Escherichia coli K-12]
GI:90111593 GenBank EGI08668.1 369 sn-glycerol-3-phosphate import ATP-binding protein UgpC [Escherichia coli H736]
GI:90111593 GenBank AGX68534.1 369 Sequence 37031 from patent US 8541208