Gene/Proteome Database (LMPD)
LMPD ID
LMP007569
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
4-diphosphocytidyl-2-C-methylerythritol kinase
Gene Symbol
Synonyms
ECK1196; JW1199; ipk; ychB
Summary
[More information is available at EcoCyc: EG11294].
Orthologs
Proteins
| 4-diphosphocytidyl-2-C-methylerythritol kinase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_415726 |
| Protein GI | 16129171 |
| UniProt ID | P62615 |
| Length | 283 |
| RefSeq Status | REVIEWED |
| MRTQWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTISIELRDDGDIRLLTPVEGVEHEDNLIVRAARLLMKTAADSGRLPTGSGANISIDKRLPMGGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADVPVFVRGHAAFAEGVGEILTPVDPPEKWYLVAHPGVSIPTPVIFKDPELPRNTPKRSIETLLKCEFSNDCEVIARKRFREVDAVLSWLLEYAPSRLTGTGACVFAEFDTESEARQVLEQAPEWLNGFVAKGANLSPLHRAML | |
Gene Information
Entrez Gene ID
Gene Name
4-diphosphocytidyl-2-C-methylerythritol kinase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0050515 | IDA:EcoCyc | F | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase activity |
| GO:0005524 | IDA:EcoCyc | F | ATP binding |
| GO:0019288 | IEA:UniProtKB-UniPathway | P | isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway |
| GO:0016114 | IEA:UniProtKB-HAMAP | P | terpenoid biosynthetic process |
| GO:0006744 | IDA:EcoCyc | P | ubiquinone biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco01110 | Biosynthesis of secondary metabolites |
| M00096 | C5 isoprenoid biosynthesis, non-mevalonate pathway |
| eco_M00096 | C5 isoprenoid biosynthesis, non-mevalonate pathway |
| eco01100 | Metabolic pathways |
| eco00900 | Terpenoid backbone biosynthesis |
| ko00900 | Terpenoid backbone biosynthesis |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| NONMEVIPP-PWY | methylerythritol phosphate pathway |
| NONMEVIPP-PWY | methylerythritol phosphate pathway |
| PWY-5121 | superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) |
| PWY-7392 | taxadiene biosynthesis (engineered) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
4-diphosphocytidyl-2-C-methylerythritol kinase
Protein Entry
ISPE_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | ATP + 4-(cytidine 5'-diphospho)-2-C-methyl-D- erythritol = ADP + 2-phospho-4-(cytidine 5'-diphospho)-2-C-methyl- D-erythritol. |
| Caution | Was originally thought to be an isopentenyl monophosphate kinase. {ECO:0000305|PubMed:1427085}. |
| Function | Catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol. Phosphorylates isopentenyl phosphate at low rates. Also acts on isopentenol, and, much less efficiently, dimethylallyl alcohol. Dimethylallyl monophosphate does not serve as a substrate. |
| Interaction | P17169:glmS; NbExp=1; IntAct=EBI-562202, EBI-551022; |
| Pathway | Isoprenoid biosynthesis; isopentenyl diphosphate biosynthesis via DXP pathway; isopentenyl diphosphate from 1- deoxy-D-xylulose 5-phosphate: step 3/6. |
| Sequence Caution | Sequence=BAA01106.1; Type=Frameshift; Positions=50; Evidence={ECO:0000305}; |
| Similarity | Belongs to the GHMP kinase family. IspE subfamily. {ECO:0000305}. |
| Subunit | Homodimer. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007569 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16129171 | RefSeq | NP_415726 | 283 | 4-diphosphocytidyl-2-C-methylerythritol kinase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007569 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129171 | GenBank | KHH93612.1 | 283 | kinase [Escherichia coli] |
| GI:16129171 | GenBank | KHH95882.1 | 283 | kinase [Escherichia coli] |
| GI:16129171 | GenBank | KHI12146.1 | 283 | kinase [Escherichia coli] |
| GI:16129171 | GenBank | KHI18397.1 | 283 | kinase [Escherichia coli] |
| GI:16129171 | GenBank | KHI55986.1 | 283 | kinase [Escherichia coli] |
| GI:16129171 | gnl | IGS | 283 | 4-diphosphocytidyl-2-C-methylerythritol kinase [Escherichia coli ER2796] |
Related Sequences to LMP007569 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16129171 | GenBank | EHN97850.1 | 283 | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Escherichia coli E101] |
| GI:16129171 | GenBank | EIQ11173.1 | 283 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase [Shigella flexneri 2850-71] |
| GI:16129171 | GenBank | EIQ13118.1 | 283 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase [Shigella flexneri CCH060] |
| GI:16129171 | GenBank | EIQ29589.1 | 283 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase [Shigella flexneri K-404] |
| GI:16129171 | RefSeq | NP_836903.1 | 283 | 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [Shigella flexneri 2a str. 2457T] |
| GI:16129171 | RefSeq | WP_001260355.1 | 283 | kinase [Escherichia coli] |