Gene/Proteome Database (LMPD)

LMPD ID
LMP007597
Gene ID
947712
Species
Escherichia coli K-12 (E. coli)
Gene Name
OM lipid asymmetry maintenance protein; membrane-anchored ABC family periplasmic binding protein
Gene Symbol
mlaD
Synonyms
ECK3182; JW3160; vpsC; yrbD
Summary
The first 28 aa are predicted to be a Type I signal peptide. [More information is available at EcoGene: EG12799].
Orthologs
View orthologs and multiple alignments for mlaD

Proteins

OM lipid asymmetry maintenance protein; membrane-anchored ABC family periplasmic binding protein [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_417660
Protein GI 16131083
UniProt ID P64604
Length 183
RefSeq Status REVIEWED
MQTKKNEIWVGIFLLAALLAALFVCLKAANVTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTYLPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTKSAMVLEDLIGQFLYGSKGDDNKNSGDAPAAAPGNNETTEPVGTTK

Gene Information

Entrez Gene ID
947712
Gene Name
OM lipid asymmetry maintenance protein; membrane-anchored ABC family periplasmic binding protein
Gene Symbol
mlaD
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0005543 IMP:EcoCyc F phospholipid binding
GO:0005548 IMP:EcoCyc F phospholipid transporter activity
GO:0015914 IMP:GOC P phospholipid transport

KEGG Pathway Links

KEGG Pathway ID Description
eco02010 ABC transporters
ko02010 ABC transporters
M00210 Phospholipid transport system
eco_M00210 Phospholipid transport system

Domain Information

InterPro Annotations

Accession Description
IPR003399 Mce-related

UniProt Annotations

Entry Information

Gene Name
OM lipid asymmetry maintenance protein; membrane-anchored ABC family periplasmic binding protein
Protein Entry
MLAD_ECOLI
UniProt ID
P64604
Species
E. coli

Comments

Comment Type Description
Disruption Phenotype Mutation confers sensitivity to SDS-EDTA and leads to accumulation of phospholipid in the outer leaflet of the outer membrane. {ECO:0000269|PubMed:19383799}.
Function Part of the ABC transporter complex MlaFEDB that actively prevents phospholipid accumulation at the cell surface. Probably maintains lipid asymmetry in the outer membrane by retrograde trafficking of phospholipids from the outer membrane to the inner membrane. {ECO:0000269|PubMed:19383799}.
Similarity Belongs to the MlaD family. {ECO:0000305}.
Subcellular Location Cell inner membrane {ECO:0000305}; Single- pass type II membrane protein {ECO:0000305}; Periplasmic side {ECO:0000305}.
Subunit The complex is composed of two ATP-binding proteins (MlaF), two transmembrane proteins (MlaE), two cytoplasmic solute- binding proteins (MlaB) and a periplamic solute-binding protein (MlaD). {ECO:0000305|PubMed:19383799}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007597 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16131083 RefSeq NP_417660 183 OM lipid asymmetry maintenance protein; membrane-anchored ABC family periplasmic binding protein [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007597 proteins

Reference Database Accession Length Protein Name
GI:16131083 GenBank KHJ01663.1 183 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:16131083 GenBank KHJ07337.1 183 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:16131083 GenBank KHJ16568.1 183 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:16131083 GenBank KHJ25795.1 183 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:16131083 GenBank KHJ26262.1 183 phospholipid ABC transporter substrate-binding protein [Escherichia coli]
GI:16131083 gnl IGS 183 ABC transporter maintaining OM lipid asymmetry, anchored periplasmic binding protein [Escherichia coli ER2796]

Related Sequences to LMP007597 proteins

Reference Database Accession Length Protein Name
GI:16131083 EMBL CDN83937.1 188 hypothetical protein EC958_3593 [Escherichia coli O25b:H4-ST131 str. EC958]
GI:16131083 GenBank EFI88138.1 188 hypothetical protein HMPREF9551_02874 [Escherichia coli MS 196-1]
GI:16131083 GenBank EGJ05674.1 188 hypothetical protein SSJG_01722 [Escherichia coli D9]
GI:16131083 gnl ncbi 188 hypothetical protein YrbD precursor [Escherichia coli UTI89]
GI:16131083 gnl REF_ncbi 188 hypothetical protein UTI89_C3629 [Escherichia coli UTI89]
GI:16131083 RefSeq WP_000510616.1 188 phospholipid ABC transporter substrate-binding protein [Escherichia coli]