Gene/Proteome Database (LMPD)

LMPD ID
LMP007636
Gene ID
948670
Species
Escherichia coli K-12 (E. coli)
Gene Name
outer membrane lipoprotein cell division and growth lipocalin
Gene Symbol
blc
Synonyms
ECK4145; JW4110; yjeL
Summary
RpoS regulon. [More information is available at EcoGene: EG12474]. The Blc protein is a globomycin-sensitive outer membrane lipoprotein . [More information is available at EcoCyc: G7837].
Orthologs
View orthologs and multiple alignments for blc

Proteins

outer membrane lipoprotein cell division and growth lipocalin [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_418573
Protein GI 16131974
UniProt ID P0A901
Length 177
RefSeq Status REVIEWED
MRLLPLVAAATAAFLVVACSSPTPPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGLEKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPGS

Gene Information

Entrez Gene ID
948670
Gene Name
outer membrane lipoprotein cell division and growth lipocalin
Gene Symbol
blc
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0009279 IEA:UniProtKB-KW C cell outer membrane
GO:0008289 IEA:UniProtKB-KW F lipid binding
GO:0005215 IEA:InterPro F transporter activity
GO:0006974 IEP:EcoliWiki P cellular response to DNA damage stimulus

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR022272 Lipocalin family conserved site
IPR022271 Lipocalin, ApoD type
IPR000566 Lipocalin/cytosolic fatty-acid binding domain
IPR002446 Lipocalin_bac

UniProt Annotations

Entry Information

Gene Name
outer membrane lipoprotein cell division and growth lipocalin
Protein Entry
BLC_ECOLI
UniProt ID
P0A901
Species
E. coli

Comments

Comment Type Description
Function Involved in the storage or transport of lipids necessary for membrane maintenance under stressful conditions. Displays a binding preference for lysophospholipids. {ECO:0000269|PubMed:15044022}.
Induction By starvation and high osmolarity.
Similarity Belongs to the calycin superfamily. Lipocalin family. {ECO:0000305}.
Subcellular Location Cell outer membrane; Lipid-anchor.
Subunit Homodimer. {ECO:0000269|PubMed:16920109}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007636 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16131974 RefSeq NP_418573 177 outer membrane lipoprotein cell division and growth lipocalin [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007636 proteins

Reference Database Accession Length Protein Name
GI:16131974 GenBank KHJ00821.1 177 membrane protein [Escherichia coli]
GI:16131974 GenBank KHJ03866.1 177 membrane protein [Escherichia coli]
GI:16131974 GenBank KHJ08616.1 177 membrane protein [Escherichia coli]
GI:16131974 GenBank KHJ19497.1 177 membrane protein [Escherichia coli]
GI:16131974 GenBank KHJ28695.1 177 membrane protein [Escherichia coli]
GI:16131974 gnl IGS 177 outer membrane lipoprotein (lipocalin), cell division and growth function [Escherichia coli ER2796]

Related Sequences to LMP007636 proteins

Reference Database Accession Length Protein Name
GI:16131974 EMBL CDK73512.1 178 Outer membrane lipoprotein Blc [Klebsiella pneumoniae IS22]
GI:16131974 GenBank EQV40076.1 178 outer membrane lipoprotein blc [Escherichia coli KOEGE 40 (102a)]
GI:16131974 GenBank ERA97255.1 178 outer membrane lipoprotein blc [Escherichia coli KOEGE 3 (4a)]
GI:16131974 GenBank ERA99057.1 178 outer membrane lipoprotein blc [Escherichia coli KOEGE 7 (16a)]
GI:16131974 GenBank ESL16804.1 178 outer membrane lipoprotein blc [Escherichia coli BIDMC 39]
GI:16131974 GenBank KHH50536.1 178 membrane protein [Escherichia coli]