Gene/Proteome Database (LMPD)
LMPD ID
LMP007651
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
periplasmic glycerophosphodiester phosphodiesterase
Gene Symbol
Synonyms
ECK2231; JW2233
Summary
None
Orthologs
Proteins
periplasmic glycerophosphodiester phosphodiesterase [Escherichia coli str. K-12 substr. MG1655] | |
---|---|
Refseq ID | NP_416742 |
Protein GI | 16130174 |
UniProt ID | P09394 |
Length | 358 |
RefSeq Status | REVIEWED |
MKLTLKNLSMAIMMSTIVMGSSAMAADSNEKIVIAHRGASGYLPEHTLPAKAMAYAQGADYLEQDLVMTKDDNLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEGFDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQEGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTDWNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMVQDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDKAVKFLNKE |
Gene Information
Entrez Gene ID
Gene Name
periplasmic glycerophosphodiester phosphodiesterase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0042597 | IDA:EcoCyc | C | periplasmic space |
GO:0005509 | IDA:EcoCyc | F | calcium ion binding |
GO:0008889 | IDA:EcoCyc | F | glycerophosphodiester phosphodiesterase activity |
GO:0046872 | IDA:EcoCyc | F | metal ion binding |
GO:0006071 | IEA:UniProtKB-KW | P | glycerol metabolic process |
GO:0006629 | IEA:InterPro | P | lipid metabolic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
eco00564 | Glycerophospholipid metabolism |
ko00564 | Glycerophospholipid metabolism |
BIOCYC Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
periplasmic glycerophosphodiester phosphodiesterase
Protein Entry
GLPQ_ECOLI
UniProt ID
Species
E. coli
Comments
Comment Type | Description |
---|---|
Biophysicochemical Properties | Kinetic parameters: KM=0.28 mM for glycerophosphocholine {ECO:0000269|PubMed:2829735}; KM=0.24 mM for glycerophosphoethanolamine {ECO:0000269|PubMed:2829735}; KM=0.35 mM for glycerophosphoglycerol {ECO:0000269|PubMed:2829735}; KM=0.59 mM for glycerophosphoserine {ECO:0000269|PubMed:2829735}; KM=1.0 mM for glycerophosphoinositol {ECO:0000269|PubMed:2829735}; pH dependence: Optimum pH is 7.8. {ECO:0000269|PubMed:2829735}; |
Catalytic Activity | A glycerophosphodiester + H(2)O = an alcohol + sn-glycerol 3-phosphate. {ECO:0000269|PubMed:2829735}. |
Cofactor | Name=Ca(2+); Xref=ChEBI:CHEBI:29108; Evidence={ECO:0000269|PubMed:2829735}; Note=Binds 1 Ca(2+) ion per subunit. {ECO:0000269|PubMed:2829735}; |
Function | Glycerophosphoryl diester phosphodiesterase hydrolyzes deacylated phospholipids to G3P and the corresponding alcohols. |
Miscellaneous | There are 2 isozymes of glycerophosphoryl diester phosphodiesterase in E.coli: a periplasmic isozyme (GlpQ) and a cytosolic isozyme (UgpQ). |
Similarity | Belongs to the glycerophosphoryl diester phosphodiesterase family. {ECO:0000305}. |
Similarity | Contains 1 GP-PDE domain. {ECO:0000305}. |
Subcellular Location | Periplasm {ECO:0000269|PubMed:2829735}. |
Subunit | Homodimer. {ECO:0000269|PubMed:2829735, ECO:0000269|Ref.10, ECO:0000269|Ref.9}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007651 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16130174 | RefSeq | NP_416742 | 358 | periplasmic glycerophosphodiester phosphodiesterase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007651 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16130174 | GenBank | KHH49030.1 | 358 | glycerophosphodiester phosphodiesterase [Escherichia coli] |
GI:16130174 | GenBank | KHH89675.1 | 358 | glycerophosphodiester phosphodiesterase [Escherichia coli] |
GI:16130174 | GenBank | KHI15545.1 | 358 | glycerophosphodiester phosphodiesterase [Escherichia coli] |
GI:16130174 | GenBank | KHI19768.1 | 358 | glycerophosphodiester phosphodiesterase [Escherichia coli] |
GI:16130174 | GenBank | KHI59997.1 | 358 | glycerophosphodiester phosphodiesterase [Escherichia coli] |
GI:16130174 | gnl | IGS | 358 | periplasmic glycerophosphodiester phosphodiesterase [Escherichia coli ER2796] |
Related Sequences to LMP007651 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16130174 | GenBank | EFK15211.1 | 371 | glycerophosphoryl diester phosphodiesterase GlpQ [Escherichia coli MS 116-1] |
GI:16130174 | GenBank | EFK89006.1 | 371 | glycerophosphoryl diester phosphodiesterase GlpQ [Escherichia coli MS 146-1] |
GI:16130174 | GenBank | EGI11887.1 | 371 | glycerophosphoryl diester phosphodiesterase GlpQ [Escherichia coli H736] |
GI:16130174 | gnl | zhongguo | 371 | Glycerophosphoryl diester phosphodiesterase [Escherichia coli P12b] |
GI:16130174 | RefSeq | YP_006169346.1 | 371 | glycerophosphoryl diester phosphodiesterase [Escherichia coli P12b] |
GI:16130174 | RefSeq | WP_001310992.1 | 371 | glycerophosphodiester phosphodiesterase [Escherichia coli] |