Gene/Proteome Database (LMPD)
LMPD ID
LMP007666
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
periplasmic membrane-anchored LPS-binding protein; LPS export protein
Gene Symbol
Synonyms
ECK3188; JW3166; yrbK
Summary
Overexpression causes abnormal biofilm architecture. [More information is available at EcoGene: EG12806]. YrbK is predicted to be an integral membrane component of the LptAB-YrbK ABC transporter. [More information is available at EcoCyc: G7664].
Orthologs
Proteins
| periplasmic membrane-anchored LPS-binding protein; LPS export protein [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_417666 |
| Protein GI | 16131089 |
| UniProt ID | P0ADV9 |
| Length | 191 |
| RefSeq Status | REVIEWED |
| MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP | |
Gene Information
Entrez Gene ID
Gene Name
periplasmic membrane-anchored LPS-binding protein; LPS export protein
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IDA:EcoCyc | C | integral component of membrane |
| GO:0005887 | IDA:EcoCyc | C | integral component of plasma membrane |
| GO:0030288 | IDA:EcoCyc | C | outer membrane-bounded periplasmic space |
| GO:0017089 | IMP:EcoCyc | F | glycolipid transporter activity |
| GO:0042802 | IPI:IntAct | F | identical protein binding |
| GO:0015221 | IEA:InterPro | F | lipopolysaccharide transmembrane transporter activity |
| GO:0046836 | IMP:GOC | P | glycolipid transport |
| GO:0015920 | IMP:EcoCyc | P | lipopolysaccharide transport |
Domain Information
UniProt Annotations
Entry Information
Gene Name
periplasmic membrane-anchored LPS-binding protein; LPS export protein
Protein Entry
LPTC_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Disruption Phenotype | Leads to irreversible cell damage, growth arrest and an extreme sensitivity to SDS. {ECO:0000269|PubMed:16765569}. |
| Function | Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. Facilitates the transfer of LPS from the inner membrane to the periplasmic protein LptA. Could be a docking site for LptA. {ECO:0000255|HAMAP-Rule:MF_01915, ECO:0000269|PubMed:16765569, ECO:0000269|PubMed:18424520, ECO:0000269|PubMed:20720015, ECO:0000269|PubMed:21169485, ECO:0000269|PubMed:21195693}. |
| Interaction | Self; NbExp=4; IntAct=EBI-1131969, EBI-1131969; P0ADV1:lptA; NbExp=3; IntAct=EBI-1131969, EBI-1132001; |
| Miscellaneous | Interacts with the LptBFG ABC transporter complex, but does not affect its ATPase activity. {ECO:0000305|PubMed:19500581}. |
| Similarity | Belongs to the LptC family. {ECO:0000255|HAMAP- Rule:MF_01915}. |
| Subcellular Location | Cell inner membrane {ECO:0000255|HAMAP- Rule:MF_01915, ECO:0000269|PubMed:18424520, ECO:0000269|PubMed:20720015}; Single-pass membrane protein {ECO:0000255|HAMAP-Rule:MF_01915, ECO:0000269|PubMed:18424520, ECO:0000269|PubMed:20720015}. |
| Subunit | Component of the lipopolysaccharide transport and assembly complex. Interacts with LptA and the LptBFG transporter complex. When overexpressed, can form homodimers in vivo. {ECO:0000255|HAMAP-Rule:MF_01915, ECO:0000269|PubMed:19500581, ECO:0000269|PubMed:20446753, ECO:0000269|PubMed:21169485, ECO:0000269|PubMed:21195693, ECO:0000269|PubMed:22668317}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007666 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16131089 | RefSeq | NP_417666 | 191 | periplasmic membrane-anchored LPS-binding protein; LPS export protein [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007666 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131089 | GenBank | KHJ07268.1 | 191 | lipopolysaccharide transporter [Escherichia coli] |
| GI:16131089 | GenBank | KHJ13768.1 | 191 | lipopolysaccharide transporter [Escherichia coli] |
| GI:16131089 | GenBank | KHJ16499.1 | 191 | lipopolysaccharide transporter [Escherichia coli] |
| GI:16131089 | GenBank | KHJ25757.1 | 191 | lipopolysaccharide transporter [Escherichia coli] |
| GI:16131089 | GenBank | KHJ26159.1 | 191 | lipopolysaccharide transporter [Escherichia coli] |
| GI:16131089 | gnl | IGS | 191 | lipopolysaccharide export, IM-tethered periplasmic protein of the LptBFGC export complex [Escherichia coli ER2796] |
Related Sequences to LMP007666 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16131089 | EMBL | CDC82016.1 | 191 | putative inner membrane protein [Escherichia coli CAG:4] |
| GI:16131089 | GenBank | EGH37765.1 | 191 | uncharacterized protein YrbK clustered with lipopolysaccharide transporter [Escherichia coli AA86] |
| GI:16131089 | GenBank | EGI14888.1 | 191 | putative inner membrane protein [Escherichia coli M605] |
| GI:16131089 | GenBank | EQS77192.1 | 191 | lipopolysaccharide export system protein lptC [Escherichia coli HVH 162 (4-5627982)] |
| GI:16131089 | GenBank | EQZ98274.1 | 191 | lipopolysaccharide export system protein lptC [Escherichia coli UMEA 3718-1] |
| GI:16131089 | RefSeq | WP_000030531.1 | 191 | MULTISPECIES: sugar ABC transporter substrate-binding protein [Escherichia] |