Gene/Proteome Database (LMPD)
LMPD ID
LMP007713
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
beta-hydroxydecanoyl thioester dehydrase
Gene Symbol
Synonyms
ECK0945; JW0937
Summary
Binds TrxA (Kumar, 2004). [More information is available at EcoGene: EG10273].
Orthologs
Proteins
| beta-hydroxydecanoyl thioester dehydrase [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_415474 |
| Protein GI | 16128921 |
| UniProt ID | P0A6Q3 |
| Length | 172 |
| RefSeq Status | REVIEWED |
| MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF | |
Gene Information
Entrez Gene ID
Gene Name
beta-hydroxydecanoyl thioester dehydrase
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-HAMAP | C | cytoplasm |
| GO:0008693 | IDA:EcoCyc | F | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase activity |
| GO:0047451 | IDA:EcoCyc | F | 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity |
| GO:0034017 | IDA:EcoCyc | F | trans-2-decenoyl-acyl-carrier-protein isomerase activity |
| GO:0006633 | IMP:EcoCyc | P | fatty acid biosynthetic process |
| GO:0008610 | IGI:EcoliWiki | P | lipid biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| eco00061 | Fatty acid biosynthesis |
| ko00061 | Fatty acid biosynthesis |
| M00083 | Fatty acid biosynthesis, elongation |
| eco_M00083 | Fatty acid biosynthesis, elongation |
| eco01212 | Fatty acid metabolism |
| ko01212 | Fatty acid metabolism |
| eco01100 | Metabolic pathways |
BIOCYC Pathway Links
| BIOCYC Pathway ID | Description |
|---|---|
| PWY0-862 | cis-dodecenoyl biosynthesis |
| PWY0-862 | cis-dodecenoyl biosynthesis |
| PWY0-862 | cis-dodecenoyl biosynthesis |
| FASYN-ELONG-PWY | fatty acid elongation -- saturated |
| FASYN-ELONG-PWY | fatty acid elongation -- saturated |
| FASYN-ELONG-PWY | fatty acid elongation -- saturated |
| PWY0-881 | superpathway of fatty acid biosynthesis I (E. coli) |
| PWY0-881 | superpathway of fatty acid biosynthesis I (E. coli) |
| PWY-6285 | superpathway of fatty acids biosynthesis (E. coli) |
| PWY-6284 | superpathway of unsaturated fatty acids biosynthesis (E. coli) |
| PWY-6284 | superpathway of unsaturated fatty acids biosynthesis (E. coli) |
Domain Information
UniProt Annotations
Entry Information
Gene Name
beta-hydroxydecanoyl thioester dehydrase
Protein Entry
FABA_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (3R)-3-hydroxydecanoyl-[acyl-carrier-protein] = trans-dec-2-enoyl-[acyl-carrier-protein] + H(2)O. {ECO:0000269|PubMed:8910376}. |
| Catalytic Activity | A (3R)-3-hydroxyacyl-[acyl-carrier protein] = a trans-2-enoyl-[acyl-carrier protein] + H(2)O. {ECO:0000269|PubMed:8910376}. |
| Catalytic Activity | Trans-dec-2-enoyl-[acyl-carrier-protein] = cis-dec-3-enoyl-[acyl-carrier-protein]. {ECO:0000269|PubMed:8910376}. |
| Function | Necessary for the introduction of cis unsaturation into fatty acids. Catalyzes the dehydration of (3R)-3-hydroxydecanoyl- ACP to E-(2)-decenoyl-ACP and then its isomerization to Z-(3)- decenoyl-ACP. Can catalyze the dehydratase reaction for beta- hydroxyacyl-ACPs with saturated chain lengths up to 16:0, being most active on intermediate chain length. Is inactive in the dehydration of long chain unsaturated beta-hydroxyacyl-ACP. {ECO:0000269|PubMed:8910376}. |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Sequence Caution | Sequence=AAA96496.1; Type=Erroneous initiation; Evidence={ECO:0000305}; |
| Similarity | Belongs to the thioester dehydratase family. FabA subfamily. {ECO:0000305}. |
| Subcellular Location | Cytoplasm. |
| Subunit | Homodimer. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007713 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16128921 | RefSeq | NP_415474 | 172 | beta-hydroxydecanoyl thioester dehydrase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16128921 | GenBank | KHJ03808.1 | 172 | 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli] |
| GI:16128921 | GenBank | KHJ08982.1 | 172 | 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli] |
| GI:16128921 | GenBank | KHJ18468.1 | 172 | 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli] |
| GI:16128921 | GenBank | KHJ25211.1 | 172 | 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli] |
| GI:16128921 | GenBank | KHJ29067.1 | 172 | 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli] |
| GI:16128921 | gnl | IGS | 172 | beta-hydroxydecanoyl thioester dehydrase [Escherichia coli ER2796] |
Related Sequences to LMP007713 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16128921 | GenBank | ETX75079.1 | 208 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 43b] |
| GI:16128921 | GenBank | ETX83478.1 | 208 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 43a] |
| GI:16128921 | GenBank | ETY00835.1 | 208 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 19B] |
| GI:16128921 | GenBank | ETY04001.1 | 208 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 19A] |
| GI:16128921 | GenBank | EZQ74329.1 | 208 | 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 82] |
| GI:16128921 | gnl | jgi | 208 | beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA [Escherichia coli DH1] |