Gene/Proteome Database (LMPD)

LMPD ID
LMP007713
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
beta-hydroxydecanoyl thioester dehydrase
Gene Symbol
Synonyms
ECK0945; JW0937
Summary
Binds TrxA (Kumar, 2004). [More information is available at EcoGene: EG10273].
Orthologs

Proteins

beta-hydroxydecanoyl thioester dehydrase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_415474
Protein GI 16128921
UniProt ID P0A6Q3
Length 172
RefSeq Status REVIEWED
MVDKRESYTKEDLLASGRGELFGAKGPQLPAPNMLMMDRVVKMTETGGNFDKGYVEAELDINPDLWFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWLGGEGKGRALGVGEVKFTGQVLPTAKKVTYRIHFKRIVNRRLIMGLADGEVLVDGRLIYTASDLKVGLFQDTSAF

Gene Information

Entrez Gene ID
Gene Name
beta-hydroxydecanoyl thioester dehydrase
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-HAMAP C cytoplasm
GO:0008693 IDA:EcoCyc F 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase activity
GO:0047451 IDA:EcoCyc F 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
GO:0034017 IDA:EcoCyc F trans-2-decenoyl-acyl-carrier-protein isomerase activity
GO:0006633 IMP:EcoCyc P fatty acid biosynthetic process
GO:0008610 IGI:EcoliWiki P lipid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00061 Fatty acid biosynthesis
ko00061 Fatty acid biosynthesis
M00083 Fatty acid biosynthesis, elongation
eco_M00083 Fatty acid biosynthesis, elongation
eco01212 Fatty acid metabolism
ko01212 Fatty acid metabolism
eco01100 Metabolic pathways

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
PWY0-862 cis-dodecenoyl biosynthesis
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
FASYN-ELONG-PWY fatty acid elongation -- saturated
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY0-881 superpathway of fatty acid biosynthesis I (E. coli)
PWY-6285 superpathway of fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)
PWY-6284 superpathway of unsaturated fatty acids biosynthesis (E. coli)

Domain Information

InterPro Annotations

Accession Description
IPR010083 FabA
IPR013114 FabA_FabZ
IPR029069 HotDog domain

UniProt Annotations

Entry Information

Gene Name
beta-hydroxydecanoyl thioester dehydrase
Protein Entry
FABA_ECOLI
UniProt ID
Species
E. coli

Comments

Comment Type Description
Catalytic Activity (3R)-3-hydroxydecanoyl-[acyl-carrier-protein] = trans-dec-2-enoyl-[acyl-carrier-protein] + H(2)O. {ECO:0000269|PubMed:8910376}.
Catalytic Activity A (3R)-3-hydroxyacyl-[acyl-carrier protein] = a trans-2-enoyl-[acyl-carrier protein] + H(2)O. {ECO:0000269|PubMed:8910376}.
Catalytic Activity Trans-dec-2-enoyl-[acyl-carrier-protein] = cis-dec-3-enoyl-[acyl-carrier-protein]. {ECO:0000269|PubMed:8910376}.
Function Necessary for the introduction of cis unsaturation into fatty acids. Catalyzes the dehydration of (3R)-3-hydroxydecanoyl- ACP to E-(2)-decenoyl-ACP and then its isomerization to Z-(3)- decenoyl-ACP. Can catalyze the dehydratase reaction for beta- hydroxyacyl-ACPs with saturated chain lengths up to 16:0, being most active on intermediate chain length. Is inactive in the dehydration of long chain unsaturated beta-hydroxyacyl-ACP. {ECO:0000269|PubMed:8910376}.
Pathway Lipid metabolism; fatty acid biosynthesis.
Sequence Caution Sequence=AAA96496.1; Type=Erroneous initiation; Evidence={ECO:0000305};
Similarity Belongs to the thioester dehydratase family. FabA subfamily. {ECO:0000305}.
Subcellular Location Cytoplasm.
Subunit Homodimer.

Identical and Related Proteins

Unique RefSeq proteins for LMP007713 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16128921 RefSeq NP_415474 172 beta-hydroxydecanoyl thioester dehydrase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007713 proteins

Reference Database Accession Length Protein Name
GI:16128921 GenBank KHJ03808.1 172 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli]
GI:16128921 GenBank KHJ08982.1 172 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli]
GI:16128921 GenBank KHJ18468.1 172 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli]
GI:16128921 GenBank KHJ25211.1 172 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli]
GI:16128921 GenBank KHJ29067.1 172 3-hydroxydecanoyl-ACP dehydratase [Escherichia coli]
GI:16128921 gnl IGS 172 beta-hydroxydecanoyl thioester dehydrase [Escherichia coli ER2796]

Related Sequences to LMP007713 proteins

Reference Database Accession Length Protein Name
GI:16128921 GenBank ETX75079.1 208 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 43b]
GI:16128921 GenBank ETX83478.1 208 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 43a]
GI:16128921 GenBank ETY00835.1 208 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 19B]
GI:16128921 GenBank ETY04001.1 208 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 19A]
GI:16128921 GenBank EZQ74329.1 208 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase [Escherichia coli BIDMC 82]
GI:16128921 gnl jgi 208 beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA [Escherichia coli DH1]