Gene/Proteome Database (LMPD)
LMPD ID
LMP007722
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
CDP-alcohol phosphatidyltransferase family inner membrane protein
Gene Symbol
Synonyms
ECK1756; JW1747
Summary
None
Orthologs
Proteins
| CDP-alcohol phosphatidyltransferase family inner membrane protein [Escherichia coli str. K-12 substr. MG1655] | |
|---|---|
| Refseq ID | NP_416272 |
| Protein GI | 90111325 |
| UniProt ID | P76226 |
| Length | 206 |
| RefSeq Status | REVIEWED |
| MLDRHLHPRIKPLLHQCVRVLDKPGITPDGLTLVGFAIGVLALPFLALGWYLAALVVILLNRLLDGLDGALARRRELTDAGGFLDISLDFLFYALVPFGFILAAPEQNALAGGWLLFAFIGTGSSFLAFAALAAKHQIDNPGYAHKSFYYLGGLTEGTETILLFVLGCLFPAWFAWFAWIFGALCWMTTFTRVWSGYLTLKSLQRQ | |
Gene Information
Entrez Gene ID
Gene Name
CDP-alcohol phosphatidyltransferase family inner membrane protein
Gene Symbol
Species
Escherichia coli K-12
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
| GO:0016780 | IEA:InterPro | F | phosphotransferase activity, for other substituted phosphate groups |
| GO:0008654 | IEA:InterPro | P | phospholipid biosynthetic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR000462 | CDP-alcohol phosphatidyltransferase |
UniProt Annotations
Entry Information
Gene Name
CDP-alcohol phosphatidyltransferase family inner membrane protein
Protein Entry
YNJF_ECOLI
UniProt ID
Species
E. coli
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the CDP-alcohol phosphatidyltransferase class-I family. {ECO:0000305}. |
| Subcellular Location | Cell inner membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007722 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 90111325 | RefSeq | NP_416272 | 206 | CDP-alcohol phosphatidyltransferase family inner membrane protein [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007722 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:90111325 | GenBank | KHI82449.1 | 206 | membrane protein [Escherichia coli] |
| GI:90111325 | GenBank | KHI99745.1 | 206 | membrane protein [Escherichia coli] |
| GI:90111325 | GenBank | KHJ15153.1 | 206 | membrane protein [Escherichia coli] |
| GI:90111325 | GenBank | KHJ19154.1 | 206 | membrane protein [Escherichia coli] |
| GI:90111325 | GenBank | KHJ28237.1 | 206 | membrane protein [Escherichia coli] |
| GI:90111325 | gnl | IGS | 206 | inner membrane protein, phosphatidylglycerophosphate synthase homolog [Escherichia coli ER2796] |
Related Sequences to LMP007722 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:90111325 | GenBank | EGI11379.1 | 208 | inner membrane protein YnjF [Escherichia coli H736] |
| GI:90111325 | GenBank | EMW35504.1 | 206 | inner membrane protein YnjF [Escherichia coli 2785200] |
| GI:90111325 | GenBank | ERB22778.1 | 206 | inner membrane protein YnjF [Escherichia coli UMEA 3151-1] |
| GI:90111325 | RefSeq | WP_001723566.1 | 206 | inner membrane protein YnjF [Escherichia coli] |
| GI:90111325 | RefSeq | WP_021559255.1 | 206 | inner membrane protein YnjF [Escherichia coli] |
| GI:90111325 | RefSeq | WP_024202197.1 | 206 | membrane protein [Escherichia coli] |