Gene/Proteome Database (LMPD)
LMPD ID
LMP007775
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
O-antigen ligase
Gene Symbol
Synonyms
ECK3612; JW3597; rfaL
Summary
The lipopolysaccharide of Escherichia coli K-12 consists of two major components: the hydrophobic lipid A moiety inserted into the outer membrane and the phosphorylated core oligosaccharide . [More information is available at EcoCyc: EG11424].
Orthologs
Proteins
O-antigen ligase [Escherichia coli str. K-12 substr. MG1655] | |
---|---|
Refseq ID | NP_418079 |
Protein GI | 16131493 |
UniProt ID | P27243 |
Length | 419 |
RefSeq Status | REVIEWED |
MLTSFKLHSLKPYTLKSSMILEIITYILCFFSMIIAFVDNTFSIKIYNITAIVCLLSLILRGRQENYNIKNLILPLSIFLIGLLDLIWYSAFKVDNSPFRATYHSYLNTAKIFIFGSFIVFLTLTSQLKSKKESVLYTLYSLSFLIAGYAMYINSIHENDRISFGVGTATGAAYSTMLIGIVSGVAILYTKKNHPFLFLLNSCAVLYVLALTQTRATLLLFPIICVAALIAYYNKSPKKFTSSIVLLIAILASIVIIFNKPIQNRYNEALNDLNSYTNANSVTSLGARLAMYEIGLNIFIKSPFSFRSAESRAESMNLLVAEHNRLRGALEFSNVHLHNEIIEAGSLKGLMGIFSTLFLYFSLFYIAYKKRALGLLILTLGIVGIGLSDVIIWARSIPIIIISAIVLLLVINNRNNTIN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005886 | IEA:UniProtKB-KW | C | plasma membrane |
GO:0008754 | IGI:EcoCyc | F | O antigen ligase activity |
GO:0009244 | IMP:EcoCyc | P | lipopolysaccharide core region biosynthetic process |
KEGG Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Function | Adds the O-antigen on the glucose group of LPS. |
Pathway | Bacterial outer membrane biogenesis; LPS core biosynthesis. |
Subcellular Location | Cell inner membrane; Multi-pass membrane protein. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007775 (as displayed in Record Overview)
Protein GI | Database | Accession | Length | Protein Name |
---|---|---|---|---|
16131493 | RefSeq | NP_418079 | 419 | O-antigen ligase [Escherichia coli str. K-12 substr. MG1655] |
Identical Sequences to LMP007775 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16131493 | EMBL | CDZ22400.1 | 419 | O-antigen ligase [Escherichia coli] |
GI:16131493 | GenBank | KGL69996.1 | 419 | O-antigen ligase [Escherichia coli NCTC 50110] |
GI:16131493 | GenBank | KGM67019.1 | 419 | O-antigen ligase [Escherichia coli] |
GI:16131493 | GenBank | KGM76140.1 | 419 | O-antigen ligase [Escherichia coli] |
GI:16131493 | GenBank | KHH63977.1 | 419 | ligase [Escherichia coli] |
GI:16131493 | gnl | IGS | 419 | O-antigen ligase [Escherichia coli ER2796] |
Related Sequences to LMP007775 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:16131493 | EMBL | CDP74584.1 | 419 | O-antigen ligase [Escherichia coli] |
GI:16131493 | EMBL | CDU41775.1 | 419 | O-antigen ligase [Escherichia coli] |
GI:16131493 | GenBank | ELE15745.1 | 419 | O-antigen ligase [Escherichia coli KTE56] |
GI:16131493 | GenBank | EQX80881.1 | 419 | O-antigen ligase [Escherichia coli UMEA 3199-1] |
GI:16131493 | RefSeq | WP_001556313.1 | 419 | O-antigen ligase [Escherichia coli] |
GI:16131493 | RefSeq | WP_021563878.1 | 419 | O-antigen ligase [Escherichia coli] |