Gene/Proteome Database (LMPD)

LMPD ID
LMP007775
Gene ID
Species
Escherichia coli K-12 (E. coli)
Gene Name
O-antigen ligase
Gene Symbol
Synonyms
ECK3612; JW3597; rfaL
Summary
The lipopolysaccharide of Escherichia coli K-12 consists of two major components: the hydrophobic lipid A moiety inserted into the outer membrane and the phosphorylated core oligosaccharide . [More information is available at EcoCyc: EG11424].
Orthologs

Proteins

O-antigen ligase [Escherichia coli str. K-12 substr. MG1655]
Refseq ID NP_418079
Protein GI 16131493
UniProt ID P27243
Length 419
RefSeq Status REVIEWED
MLTSFKLHSLKPYTLKSSMILEIITYILCFFSMIIAFVDNTFSIKIYNITAIVCLLSLILRGRQENYNIKNLILPLSIFLIGLLDLIWYSAFKVDNSPFRATYHSYLNTAKIFIFGSFIVFLTLTSQLKSKKESVLYTLYSLSFLIAGYAMYINSIHENDRISFGVGTATGAAYSTMLIGIVSGVAILYTKKNHPFLFLLNSCAVLYVLALTQTRATLLLFPIICVAALIAYYNKSPKKFTSSIVLLIAILASIVIIFNKPIQNRYNEALNDLNSYTNANSVTSLGARLAMYEIGLNIFIKSPFSFRSAESRAESMNLLVAEHNRLRGALEFSNVHLHNEIIEAGSLKGLMGIFSTLFLYFSLFYIAYKKRALGLLILTLGIVGIGLSDVIIWARSIPIIIISAIVLLLVINNRNNTIN

Gene Information

Entrez Gene ID
Gene Name
O-antigen ligase
Gene Symbol
Species
Escherichia coli K-12

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005886 IEA:UniProtKB-KW C plasma membrane
GO:0008754 IGI:EcoCyc F O antigen ligase activity
GO:0009244 IMP:EcoCyc P lipopolysaccharide core region biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
eco00540 Lipopolysaccharide biosynthesis
ko00540 Lipopolysaccharide biosynthesis
eco01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
O-antigen ligase
Protein Entry
RFAL_ECOLI
UniProt ID
Species
E. coli

Comments

Comment Type Description
Function Adds the O-antigen on the glucose group of LPS.
Pathway Bacterial outer membrane biogenesis; LPS core biosynthesis.
Subcellular Location Cell inner membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP007775 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16131493 RefSeq NP_418079 419 O-antigen ligase [Escherichia coli str. K-12 substr. MG1655]

Identical Sequences to LMP007775 proteins

Reference Database Accession Length Protein Name
GI:16131493 EMBL CDZ22400.1 419 O-antigen ligase [Escherichia coli]
GI:16131493 GenBank KGL69996.1 419 O-antigen ligase [Escherichia coli NCTC 50110]
GI:16131493 GenBank KGM67019.1 419 O-antigen ligase [Escherichia coli]
GI:16131493 GenBank KGM76140.1 419 O-antigen ligase [Escherichia coli]
GI:16131493 GenBank KHH63977.1 419 ligase [Escherichia coli]
GI:16131493 gnl IGS 419 O-antigen ligase [Escherichia coli ER2796]

Related Sequences to LMP007775 proteins

Reference Database Accession Length Protein Name
GI:16131493 EMBL CDP74584.1 419 O-antigen ligase [Escherichia coli]
GI:16131493 EMBL CDU41775.1 419 O-antigen ligase [Escherichia coli]
GI:16131493 GenBank ELE15745.1 419 O-antigen ligase [Escherichia coli KTE56]
GI:16131493 GenBank EQX80881.1 419 O-antigen ligase [Escherichia coli UMEA 3199-1]
GI:16131493 RefSeq WP_001556313.1 419 O-antigen ligase [Escherichia coli]
GI:16131493 RefSeq WP_021563878.1 419 O-antigen ligase [Escherichia coli]