Gene/Proteome Database (LMPD)
Proteins
Protein F35C8.5 | |
---|---|
Refseq ID | NP_508912 |
Protein GI | 17567475 |
UniProt ID | Q20027 |
mRNA ID | NM_076511 |
Length | 300 |
MLDLYPVQNLTVDQLEYEKNTRFLQPAWDWIKNGNEHILSSPLFPPFYALSIDYTWVAVFTFIDVFLCNVPFFKDAKIQKDRKVTWDLIKKSLKLQGWNQLLWIYPMALVQLIWVPDTELPILAPTVFEMLSQLAIFFLAFDFTYFWFHYINHKVKWLYRWCHSVHHMYSSPFAASAQHLHPFELFFVGTFITTIPWIFPTHCLTYWIWFFIAQSVSYEVHIGYDFPFALHRIFWFYSGAPAHDMHHLRPLTCFQPWFNYLDRLMGYHITYADLKKMTEAKFKKFGLYSAEDEKGLIKIN |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0005506 | IEA:InterPro | F | iron ion binding |
GO:0016491 | IEA:UniProtKB-KW | F | oxidoreductase activity |
GO:0006633 | IEA:InterPro | P | fatty acid biosynthetic process |
GO:0016126 | IEA:UniProtKB-KW | P | sterol biosynthetic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
Accession | Description |
---|---|
IPR006694 | Fatty_acid_hydroxylase |
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence= ; |
Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; |
Function | Probable sterol desaturase |
Function | Probable sterol desaturase. {ECO:0000250}. |
Similarity | Belongs to the sterol desaturase family |
Similarity | Belongs to the sterol desaturase family. {ECO:0000305}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Subcellular Location | Membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP007818 (as displayed in Record Overview)
Identical Sequences to LMP007818 proteins
Reference | Database | Accession | Length | Protein Name |
---|
Related Sequences to LMP007818 proteins
Reference | Database | Accession | Length | Protein Name |
---|