Gene/Proteome Database (LMPD)
Proteins
| Protein ELO-6 | |
|---|---|
| Refseq ID | NP_500797 |
| Protein GI | 17540338 |
| UniProt ID | Q20303 |
| mRNA ID | NM_068396 |
| Length | 274 |
| RefSeq Status | REVIEWED |
| MPQGEVSFFEVLTTAPFSHELSKKHIAQTQYAAFWISMAYVVVIFGLKAVMTNRKPFDLTGPLNLWNAGLAIFSTLGSLATTFGLLHEFFSRGFFESYIHIGDFYNGLSGMFTWLFVLSKVAEFGDTLFIILRKKPLMFLHWYHHVLTMNYAFMSFEANLGFNTWITWMNFSVHSIMYGYYMLRSFGVKVPAWIAKNITTMQILQFVITHFILFHVGYLAVTGQSVDSTPGYYWFCLLMEISYVVLFGNFYYQSYIKGGGKKFNAEKKTEKKIE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). {ECO:0000269|PubMed:15340492}. |
| Function | Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs) and monomethyl branched-chain fatty acids (mmBCFAs). Required for the formation of isoheptadecanoate (C17iso). {ECO:0000269|PubMed:15340492}. |
| Pathway | Lipid metabolism; fatty acid biosynthesis. {ECO:0000269|PubMed:15340492}. |
| Similarity | Belongs to the ELO family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Expressed in the gut, neurons, pharynx and muscles of the vulva. {ECO:0000269|PubMed:15340492}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007869 (as displayed in Record Overview)
Identical Sequences to LMP007869 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17540338 | EMBL | CCD71101.1 | 274 | Protein ELO-6 [Caenorhabditis elegans] |
| GI:17540338 | SwissProt | Q20303.1 | 274 | RecName: Full=Elongation of very long chain fatty acids protein 6; AltName: Full=3-keto acyl-CoA synthase elo-6; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 6 [Caenorhabditis elegans] |
Related Sequences to LMP007869 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17540338 | EMBL | CAP37099.1 | 272 | Protein CBR-ELO-6 [Caenorhabditis briggsae] |
| GI:17540338 | GenBank | EFP07179.1 | 276 | CRE-ELO-6 protein [Caenorhabditis remanei] |
| GI:17540338 | GenBank | EGT40138.1 | 276 | CBN-ELO-6 protein [Caenorhabditis brenneri] |
| GI:17540338 | GenBank | EYC05986.1 | 268 | hypothetical protein Y032_0079g1288 [Ancylostoma ceylanicum] |
| GI:17540338 | RefSeq | XP_002633891.1 | 272 | C. briggsae CBR-ELO-6 protein [Caenorhabditis briggsae] |
| GI:17540338 | RefSeq | XP_003101325.1 | 276 | CRE-ELO-6 protein [Caenorhabditis remanei] |