Gene/Proteome Database (LMPD)

LMPD ID
LMP007869
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein ELO-6
Gene Symbol
Synonyms
CELE_F41H10.8
Alternate Names
Protein ELO-6
Chromosome
IV
EC Number
2.3.1.199

Proteins

Protein ELO-6
Refseq ID NP_500797
Protein GI 17540338
UniProt ID Q20303
mRNA ID NM_068396
Length 274
RefSeq Status REVIEWED
MPQGEVSFFEVLTTAPFSHELSKKHIAQTQYAAFWISMAYVVVIFGLKAVMTNRKPFDLTGPLNLWNAGLAIFSTLGSLATTFGLLHEFFSRGFFESYIHIGDFYNGLSGMFTWLFVLSKVAEFGDTLFIILRKKPLMFLHWYHHVLTMNYAFMSFEANLGFNTWITWMNFSVHSIMYGYYMLRSFGVKVPAWIAKNITTMQILQFVITHFILFHVGYLAVTGQSVDSTPGYYWFCLLMEISYVVLFGNFYYQSYIKGGGKKFNAEKKTEKKIE

Gene Information

Entrez Gene ID
Gene Name
Protein ELO-6
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016740 IEA:UniProtKB-KW F transferase activity
GO:0006633 IEA:UniProtKB-UniPathway P fatty acid biosynthetic process

REACTOME Pathway Links

REACTOME Pathway ID Description
5653424 Activation of gene expression by SREBF (SREBP)
5652674 Fatty Acyl-CoA Biosynthesis
5653425 Regulation of cholesterol biosynthesis by SREBP (SREBF)
5652683 Synthesis of very long-chain fatty acyl-CoAs

Domain Information

InterPro Annotations

Accession Description
IPR002076 ELO family

UniProt Annotations

Entry Information

Gene Name
Protein ELO-6
Protein Entry
ELO6_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). {ECO:0000269|PubMed:15340492}.
Function Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs) and monomethyl branched-chain fatty acids (mmBCFAs). Required for the formation of isoheptadecanoate (C17iso). {ECO:0000269|PubMed:15340492}.
Pathway Lipid metabolism; fatty acid biosynthesis. {ECO:0000269|PubMed:15340492}.
Similarity Belongs to the ELO family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Expressed in the gut, neurons, pharynx and muscles of the vulva. {ECO:0000269|PubMed:15340492}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007869 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17540338 RefSeq NP_500797 274 Protein ELO-6

Identical Sequences to LMP007869 proteins

Reference Database Accession Length Protein Name
GI:17540338 EMBL CCD71101.1 274 Protein ELO-6 [Caenorhabditis elegans]
GI:17540338 SwissProt Q20303.1 274 RecName: Full=Elongation of very long chain fatty acids protein 6; AltName: Full=3-keto acyl-CoA synthase elo-6; AltName: Full=Very-long-chain 3-oxoacyl-CoA synthase 6 [Caenorhabditis elegans]

Related Sequences to LMP007869 proteins

Reference Database Accession Length Protein Name
GI:17540338 EMBL CAP37099.1 272 Protein CBR-ELO-6 [Caenorhabditis briggsae]
GI:17540338 GenBank EFP07179.1 276 CRE-ELO-6 protein [Caenorhabditis remanei]
GI:17540338 GenBank EGT40138.1 276 CBN-ELO-6 protein [Caenorhabditis brenneri]
GI:17540338 GenBank EYC05986.1 268 hypothetical protein Y032_0079g1288 [Ancylostoma ceylanicum]
GI:17540338 RefSeq XP_002633891.1 272 C. briggsae CBR-ELO-6 protein [Caenorhabditis briggsae]
GI:17540338 RefSeq XP_003101325.1 276 CRE-ELO-6 protein [Caenorhabditis remanei]