Gene/Proteome Database (LMPD)
Proteins
| Protein HYL-1 | |
|---|---|
| Refseq ID | NP_501459 |
| Protein GI | 17541106 |
| UniProt ID | G5ED45 |
| mRNA ID | NM_069058 |
| Length | 368 |
| RefSeq Status | REVIEWED |
| MWRMSYFWHEPYWLPRNVTWPEVPAKFVDLLVPIYLAIPLVIIRILWESTIGVTYLYFRTNAYASRKNITLLGCMWEHMTGGFASVSRAKKILECFWRFSYYTFAFLYGLYVMKNSSWLYDVKQCWIGYPFHPVPDTIWWYYMIETGFYYSLLIGSTFDVRRSDFWQLMVHHVITIFLLSSSWTINFVRVGTLILLSHDVSDVFLEGGKLVRYDAHNKNMTNFMFVLFFSSWVATRLIYYPFIVIRSAVTEAAALIQPDYILWDYQLSPPYAPRLIVFALILLFFLHIFWTFIILRIAYRTSTGGQAKDVRSDSDSDYDEEEMARRERTRLLKKKKNKVSPSTDDDDDEGEEEKNDRKARHRRAPRKE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030424 | IDA:WormBase | C | axon |
| GO:0005789 | ISS:WormBase | C | endoplasmic reticulum membrane |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0050291 | IEA:UniProtKB-EC | F | sphingosine N-acyltransferase activity |
| GO:0007568 | ISS:WormBase | P | aging |
| GO:0046513 | ISS:WormBase | P | ceramide biosynthetic process |
| GO:0040012 | IMP:WormBase | P | regulation of locomotion |
KEGG Pathway Links
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-CoA + sphingosine = CoA + N- acylsphingosine. {ECO:0000269|PubMed:19372430}. |
| Function | Catalyzes the acylation of sphingosine to form ceramides. Exhibits substrate preference for fatty acyl-coA chains containing 24 and 26 carbons. {ECO:0000269|PubMed:19372430}. |
| Pathway | Lipid metabolism; sphingolipid metabolism. {ECO:0000269|PubMed:19372430}. |
| Similarity | Belongs to the sphingosine N-acyltransferase family. {ECO:0000305}. |
| Similarity | Contains 1 TLC (TRAM/LAG1/CLN8) domain. {ECO:0000255|PROSITE-ProRule:PRU00205}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007871 (as displayed in Record Overview)
Identical Sequences to LMP007871 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17541106 | EMBL | CCD63994.1 | 368 | Protein HYL-1, isoform a [Caenorhabditis elegans] |
| GI:17541106 | GenBank | AAD16893.1 | 368 | LAG1Ce-1 [Caenorhabditis elegans] |
| GI:17541106 | SwissProt | G5ED45.1 | 368 | RecName: Full=Ceramide synthase hyl-1 [Caenorhabditis elegans] |
Related Sequences to LMP007871 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17541106 | EMBL | CDO41071.1 | 372 | Protein HYL-1, isoform b [Caenorhabditis elegans] |
| GI:17541106 | GenBank | EFO94018.1 | 366 | CRE-HYL-1 protein [Caenorhabditis remanei] |
| GI:17541106 | GenBank | EGT49358.1 | 364 | hypothetical protein CAEBREN_29125 [Caenorhabditis brenneri] |
| GI:17541106 | PIR | - | 362 | hypothetical protein C09G4.1 - Caenorhabditis elegans [Caenorhabditis elegans] |
| GI:17541106 | RefSeq | XP_003089272.1 | 382 | hypothetical protein CRE_23809 [Caenorhabditis remanei] |
| GI:17541106 | RefSeq | XP_003093525.1 | 366 | CRE-HYL-1 protein [Caenorhabditis remanei] |