Gene/Proteome Database (LMPD)
Proteins
| Protein ELO-4 | |
|---|---|
| Refseq ID | NP_499056 |
| Protein GI | 17552588 |
| UniProt ID | Q03574 |
| mRNA ID | NM_066655 |
| Length | 291 |
| MELAEFWNDLNTFTIYGPNHTDMTTKYKYSYHFPGEQVADPQYWTILFQKYWYHSITISVLYFILIKVIQKFMENRKPFTLKYPLILWNGALAAFSIIATLRFSIDPLRSLYAEGFYKTLCYSCNPTDVAAFWSFAFALSKIVELGDTMFIILRKRPLIFLHYYHHAAVLIYTVHSGAEHTAAGRFYILMNYFAHSLMYTYYTVSAMGYRLPKWVSMTVTTVQTTQMLAGVGITWMVYKVKTEYKLPCQQSVANLYLAFVIYVTFAILFIQFFVKAYIIKSSKKSKSVKNE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0030176 | ISS:UniProtKB | C | integral component of endoplasmic reticulum membrane |
| GO:0016740 | IEA:UniProtKB-KW | F | transferase activity |
| GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5653424 | Activation of gene expression by SREBF (SREBP) |
| 5652674 | Fatty Acyl-CoA Biosynthesis |
| 5652529 | Fatty acid, triacylglycerol, and ketone body metabolism |
| 5652491 | Metabolism |
| 5652530 | Metabolism of lipids and lipoproteins |
| 5653425 | Regulation of cholesterol biosynthesis by SREBP (SREBF) |
| 5652683 | Synthesis of very long-chain fatty acyl-CoAs |
| 5652675 | Triglyceride Biosynthesis |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR002076 | ELO family |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | A very-long-chain acyl-CoA + malonyl-CoA = CoA + a very-long-chain 3-oxoacyl-CoA + CO(2). |
| Function | Could be implicated in synthesis of very long chain fatty acids |
| Function | Could be implicated in synthesis of very long chain fatty acids. {ECO:0000250}. |
| Pathway | Lipid metabolism; fatty acid biosynthesis. |
| Similarity | Belongs to the ELO family |
| Similarity | Belongs to the ELO family. {ECO:0000305}. |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007903 (as displayed in Record Overview)
Identical Sequences to LMP007903 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007903 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|