Gene/Proteome Database (LMPD)
Proteins
| Protein F19H6.4 | |
|---|---|
| Refseq ID | NP_510077 |
| Protein GI | 17567167 |
| UniProt ID | Q19605 |
| mRNA ID | NM_077676 |
| Length | 243 |
| MREILLTMAWAMIGMAVIVFLALTRGFTAGYGRYADRSKYGINPKLAWFIQEAPAFFIPLYYLRRGPSNSGYELNAAFLFHYFFRALIYPCRIRSTTKSPVAIVAAATFFCAYNGFLQGYWNAFYQPEEPWTTRKLVGSLMYCTGMYINHKSDTILRELRADGGTGYKIPTGFLYEYISCPNYAGEIMEWIGYSILAWNLPALAFAIFTIANIGPRAVAHHKWYKETFPGYPPNRRILIPRIF | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:InterPro | C | cytoplasm |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0003865 | IEA:InterPro | F | 3-oxo-5-alpha-steroid 4-dehydrogenase activity |
| GO:0008202 | IEA:InterPro | P | steroid metabolic process |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP007905 (as displayed in Record Overview)
Identical Sequences to LMP007905 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|
Related Sequences to LMP007905 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|