Gene/Proteome Database (LMPD)

LMPD ID
LMP007918
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein GLY-2
Gene Symbol
Synonyms
CELE_C55B7.2
Alternate Names
Protein GLY-2
Chromosome
I
EC Number
2.4.1.155

Proteins

Protein GLY-2
Refseq ID NP_491874
Protein GI 17507885
UniProt ID Q9NDH7
mRNA ID NM_059473
Length 669
RefSeq Status REVIEWED
MRRRHRCVALLFIFSAFITPLGFFYYTISNESKRYSEESEKNYGYQTLEFTESPEEISVDFDKYSQSECSRFPSNVEIEYPECLNKMKWIKNGWKTHHCYIENHIDGSECSFRYYLSQVENYCPPMEHHGKRKGLAKISPSIRRLLPIFESIPHYMKTRINRLWKKWKEGAHEVMQKYPKSMIERRKLNVLVFIGFLANEQKLNMAKKSDHGGPLGELLQWSDLLATLSVIGHHLEVSTNKNTLRNIVWKYMSRGPCQYVNNFRQQLDIIFTDIMGFNILRQHHRQFLLSNRCRIRLLDSFGTHAEFTTKTYFVQNKKSLSGPFSQRNPWGGHGLDLRQHWTFYPHSDDNTFLGFVVDTEGIDKKNNQMIPSALVYGKEQYMWRDAEKPIDVLKRIVTVHSTVADLDLKDSNISSIFKKVQNHGFLNSEEISQLLDNITIFFGLGFPLEGPAPLEAMAHGAVFINAKFKEPKSRLNYKFLAEKPTLRKWTSQNPYMEKIGEPHVITVDIFNELELEEAIKRAISLKPKHFVPFEFTPAGMLHRVALLLEKQELCDKIAYSKRWPPIDQMKIFRTLNADDSCETICHSKQLLCEPSYFPIINSSPLLRRENLCSSTTSDSSPFAPFNCTIQQSAFLFSCASSPPISFEINRLCPCRDYIPEQHAICKKCL

Gene Information

Entrez Gene ID
Gene Name
Protein GLY-2
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005795 TAS:WormBase C Golgi stack
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005634 IDA:WormBase C nucleus
GO:0030144 IEA:UniProtKB-EC F alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity
GO:0005516 IPI:WormBase F calmodulin binding
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0016758 IDA:WormBase F transferase activity, transferring hexosyl groups
GO:0006487 IDA:WormBase P protein N-linked glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
cel01100 Metabolic pathways
cel00510 N-Glycan biosynthesis
ko00510 N-Glycan biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5653335 N-Glycan antennae elongation

Domain Information

InterPro Annotations

Accession Description
IPR026116 Glycosyltransferase family 18

UniProt Annotations

Entry Information

Gene Name
Protein GLY-2
Protein Entry
GLY2_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Catalytic Activity UDP-N-acetyl-D-glucosamine + 6-(2-(N-acetyl- beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R = UDP + 6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D- mannosyl-R.
Developmental Stage In embryos, expressed from the late comma stage. {ECO:0000269|PubMed:11937505}.
Function Catalyzes the addition of N-acetylglucosamine (GlcNAc) in beta 1-6 linkage to the alpha-linked mannose of biantennary N- linked oligosaccharides. {ECO:0000269|PubMed:11937505}.
Pathway Protein modification; protein glycosylation.
Similarity Belongs to the glycosyltransferase 18 family. {ECO:0000305}.
Subcellular Location Golgi apparatus membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}.
Tissue Specificity Expressed in a complex subset of neurons in larvae and in the spermathecal and pharyngeal-intestinal valves and certain vulval cells of adults. {ECO:0000269|PubMed:11937505}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007918 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17507885 RefSeq NP_491874 669 Protein GLY-2

Identical Sequences to LMP007918 proteins

Reference Database Accession Length Protein Name
GI:17507885 EMBL CCD68089.1 669 Protein GLY-2 [Caenorhabditis elegans]
GI:17507885 GenBank AAF74523.1 669 N-acetylglucosaminyltransferase V [Caenorhabditis elegans]
GI:17507885 GenBank AAK94767.1 669 GLY-2 [Caenorhabditis elegans]
GI:17507885 SwissProt Q9NDH7.1 669 RecName: Full=Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase; AltName: Full=GlcNAc-TV; AltName: Full=Glycosylation-related protein 2; AltName: Full=N-acetylglucosaminyltransferase gly-2 [Caenorhabditis elegans]

Related Sequences to LMP007918 proteins

Reference Database Accession Length Protein Name
GI:17507885 EMBL CAP31593.2 671 Protein CBR-GLY-2 [Caenorhabditis briggsae]
GI:17507885 GenBank AAK94765.1 661 GLY-2, partial [Caenorhabditis elegans]
GI:17507885 GenBank EFP10352.1 677 CRE-GLY-2 protein [Caenorhabditis remanei]
GI:17507885 GenBank EGT41054.1 610 hypothetical protein CAEBREN_32321 [Caenorhabditis brenneri]
GI:17507885 RefSeq XP_002640146.1 547 C. briggsae CBR-GLY-2 protein [Caenorhabditis briggsae]
GI:17507885 RefSeq XP_003099744.1 677 CRE-GLY-2 protein [Caenorhabditis remanei]