Gene/Proteome Database (LMPD)
LMPD ID
LMP007933
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein Y52B11A.8
Gene Symbol
Synonyms
CELE_Y52B11A.8
Alternate Names
Protein Y52B11A.8
Chromosome
I
Proteins
Protein Y52B11A.8 | |
---|---|
Refseq ID | NP_492859 |
Protein GI | 17510211 |
UniProt ID | Q9U256 |
mRNA ID | NM_060458 |
Length | 174 |
RefSeq Status | REVIEWED |
MRGLLVATWIFVSVAASATPTTTTKSPPPTTTTLSPQILKAKLPPVVKNATWECGTDEFTKSISEGEIQAKCPKLRDHINSCCLQHDGCYEAQSGQKFCDDTFCSCLERRSRSSKSCHDESAPLFCDLVRTFGDGAYEASGPNASTTEESPAEKDDYDYESHVAGLNATPSSST |
Gene Information
Entrez Gene ID
Gene Name
Protein Y52B11A.8
Gene Symbol
Species
Caenorhabditis elegans
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005576 | IEA:UniProtKB-KW | C | extracellular region |
GO:0004623 | IEA:InterPro | F | phospholipase A2 activity |
GO:0016042 | IEA:InterPro | P | lipid catabolic process |
GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Caution | Although strongly related to the phospholipase A2 family, it lacks the conserved active Asp in position 129, which is replaced by a Val residue, suggesting that it has no activity. {ECO:0000305}. |
Similarity | Belongs to the phospholipase A2 family. {ECO:0000305}. |
Subcellular Location | Secreted {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007933 (as displayed in Record Overview)
Identical Sequences to LMP007933 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17510211 | EMBL | CAB63390.1 | 174 | Protein Y52B11A.8 [Caenorhabditis elegans] |
GI:17510211 | SwissProt | Q9U256.1 | 174 | RecName: Full=Phospholipase A2-like protein Y52B11A.8; Flags: Precursor [Caenorhabditis elegans] |
Related Sequences to LMP007933 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17510211 | EMBL | CAP20543.2 | 185 | Protein CBG23784 [Caenorhabditis briggsae] |
GI:17510211 | GenBank | EFP03064.1 | 176 | hypothetical protein CRE_28595 [Caenorhabditis remanei] |
GI:17510211 | GenBank | EGT32318.1 | 174 | hypothetical protein CAEBREN_20782 [Caenorhabditis brenneri] |
GI:17510211 | GenBank | EYB93684.1 | 187 | hypothetical protein Y032_0180g825 [Ancylostoma ceylanicum] |
GI:17510211 | RefSeq | XP_002647910.1 | 170 | Hypothetical protein CBG23784 [Caenorhabditis briggsae] |
GI:17510211 | RefSeq | XP_003114929.1 | 176 | hypothetical protein CRE_28595 [Caenorhabditis remanei] |