Gene/Proteome Database (LMPD)

LMPD ID
LMP007933
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein Y52B11A.8
Gene Symbol
Synonyms
CELE_Y52B11A.8
Alternate Names
Protein Y52B11A.8
Chromosome
I

Proteins

Protein Y52B11A.8
Refseq ID NP_492859
Protein GI 17510211
UniProt ID Q9U256
mRNA ID NM_060458
Length 174
RefSeq Status REVIEWED
MRGLLVATWIFVSVAASATPTTTTKSPPPTTTTLSPQILKAKLPPVVKNATWECGTDEFTKSISEGEIQAKCPKLRDHINSCCLQHDGCYEAQSGQKFCDDTFCSCLERRSRSSKSCHDESAPLFCDLVRTFGDGAYEASGPNASTTEESPAEKDDYDYESHVAGLNATPSSST

Gene Information

Entrez Gene ID
Gene Name
Protein Y52B11A.8
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0004623 IEA:InterPro F phospholipase A2 activity
GO:0016042 IEA:InterPro P lipid catabolic process
GO:0006644 IEA:InterPro P phospholipid metabolic process

Domain Information

InterPro Annotations

Accession Description
IPR016090 Phospholipase A2 domain
IPR013090 Phospholipase A2, active site

UniProt Annotations

Entry Information

Gene Name
Protein Y52B11A.8
Protein Entry
PA2L_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Caution Although strongly related to the phospholipase A2 family, it lacks the conserved active Asp in position 129, which is replaced by a Val residue, suggesting that it has no activity. {ECO:0000305}.
Similarity Belongs to the phospholipase A2 family. {ECO:0000305}.
Subcellular Location Secreted {ECO:0000305}.

Identical and Related Proteins

Unique RefSeq proteins for LMP007933 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17510211 RefSeq NP_492859 174 Protein Y52B11A.8

Identical Sequences to LMP007933 proteins

Reference Database Accession Length Protein Name
GI:17510211 EMBL CAB63390.1 174 Protein Y52B11A.8 [Caenorhabditis elegans]
GI:17510211 SwissProt Q9U256.1 174 RecName: Full=Phospholipase A2-like protein Y52B11A.8; Flags: Precursor [Caenorhabditis elegans]

Related Sequences to LMP007933 proteins

Reference Database Accession Length Protein Name
GI:17510211 EMBL CAP20543.2 185 Protein CBG23784 [Caenorhabditis briggsae]
GI:17510211 GenBank EFP03064.1 176 hypothetical protein CRE_28595 [Caenorhabditis remanei]
GI:17510211 GenBank EGT32318.1 174 hypothetical protein CAEBREN_20782 [Caenorhabditis brenneri]
GI:17510211 GenBank EYB93684.1 187 hypothetical protein Y032_0180g825 [Ancylostoma ceylanicum]
GI:17510211 RefSeq XP_002647910.1 170 Hypothetical protein CBG23784 [Caenorhabditis briggsae]
GI:17510211 RefSeq XP_003114929.1 176 hypothetical protein CRE_28595 [Caenorhabditis remanei]