Gene/Proteome Database (LMPD)
Proteins
Protein ART-1 | |
---|---|
Refseq ID | NP_495430 |
Protein GI | 17531783 |
UniProt ID | Q9N5Y2 |
mRNA ID | NM_063029 |
Length | 308 |
RefSeq Status | REVIEWED |
MSGILEVYDAKRTDNLIITLEGISGSETIKAIKKRIAQKKLKLTEERQALRVEPKGKPLADDQKLSDLGLSSQKAVLYVRDLGPQIAWKTVFMAEYAGPLFVYPLFYLRPTFIYGQAAVNATMHPAVQIAFFAWSFHYAKRLFETQFIHRFGNSTMPQFNLVKNCSYYWGFAAFVAYFVNHPLFTPPAFGDLQVYFGLAGFVISEFGNLSIHILLRNLRPAGTRERRIPKPDGNPLSLLFNYVSCPNYTYEVASWIFFSIMVQSLPAIIFTTAGFAQMAIWAQGKHRNYLKEFPDYPKNRKAIVPFVL |
Gene Information
Gene Ontology (GO Annotations)
GO ID | Source | Type | Description |
---|---|---|---|
GO:0005737 | IEA:InterPro | C | cytoplasm |
GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
GO:0016627 | IEA:InterPro | F | oxidoreductase activity, acting on the CH-CH group of donors |
GO:0006633 | IEA:UniProtKB-UniPathway | P | fatty acid biosynthetic process |
KEGG Pathway Links
KEGG Pathway ID | Description |
---|---|
cel01040 | Biosynthesis of unsaturated fatty acids |
cel00062 | Fatty acid elongation |
cel01212 | Fatty acid metabolism |
REACTOME Pathway Links
REACTOME Pathway ID | Description |
---|---|
5652683 | Synthesis of very long-chain fatty acyl-CoAs |
Domain Information
UniProt Annotations
Entry Information
Comments
Comment Type | Description |
---|---|
Catalytic Activity | A very-long-chain acyl-CoA + NADP(+) = a very- long-chain trans-2,3-dehydroacyl-CoA + NADPH. |
Function | Reduces trans-2,3-acyl-CoA to acyl-CoA of long and very long chain fatty acids. {ECO:0000250}. |
Pathway | Lipid metabolism; fatty acid biosynthesis. |
Similarity | Belongs to the steroid 5-alpha reductase family. {ECO:0000305}. |
Similarity | Contains 1 ubiquitin-like domain. {ECO:0000255|PROSITE-ProRule:PRU00214}. |
Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007946 (as displayed in Record Overview)
Identical Sequences to LMP007946 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17531783 | EMBL | CCD64616.1 | 308 | Protein ART-1 [Caenorhabditis elegans] |
GI:17531783 | SwissProt | Q9N5Y2.1 | 308 | RecName: Full=Probable very-long-chain enoyl-CoA reductase art-1 [Caenorhabditis elegans] |
Related Sequences to LMP007946 proteins
Reference | Database | Accession | Length | Protein Name |
---|---|---|---|---|
GI:17531783 | EMBL | CAP30391.2 | 329 | Protein CBR-ART-1 [Caenorhabditis briggsae] |
GI:17531783 | GenBank | EFP07719.1 | 308 | CRE-ART-1 protein [Caenorhabditis remanei] |
GI:17531783 | GenBank | EGT55808.1 | 308 | CBN-ART-1 protein [Caenorhabditis brenneri] |
GI:17531783 | GenBank | ETN69804.1 | 309 | trans-2,3-enoyl-CoA reductase [Necator americanus] |
GI:17531783 | RefSeq | XP_002630463.1 | 308 | C. briggsae CBR-ART-1 protein [Caenorhabditis briggsae] |
GI:17531783 | RefSeq | XP_003113807.1 | 308 | CRE-ART-1 protein [Caenorhabditis remanei] |