Gene/Proteome Database (LMPD)
Proteins
| Protein C14A4.3 | |
|---|---|
| Refseq ID | NP_496282 |
| Protein GI | 32564301 |
| UniProt ID | P54002 |
| mRNA ID | NM_063881 |
| Length | 603 |
| RefSeq Status | REVIEWED |
| MVTHRRKGGSGPPQKPPPRIVDRSSFDADKKKIKVEKLYHKANNPDNDWPFSFGSVFKMLLSIRISGAIWGIINDCDEVYNYWEPLHLFLYGEGFQTWEYSPVYAIRSYFYIYLHYIPASLFANLFGDTKIVVFTLIRLTIGLFCLLGEYYAFDAICKKINIATGRFFILFSIFSSGMFLASTAFVPSSFCMAITFYILGAYLNENWTAGIFCVAFSTMVGWPFSAVLGLPIVADMLLLKGLRIRFILTSLVIGLCIGGVQVITDSHYFGKTVLAPLNIFLYNVVSGPGPSLYGEEPLSFYIKNLFNNWNIVIFAAPFGFPLSLAYFTKVWMSQDRNVALYQRFAPIILLAVTTAAWLLIFGSQAHKEERFLFPIYPFIAFFAALALDATNRLCLKKLGMDNILSILFILCFAILSASRTYSIHNNYGSHVEIYRSLNAELTNRTNFKNFHDPIRVCVGKEWHRFPSSFFIPQTVSDGKKVEMRFIQSEFRGLLPKPFLKSDKLVEVTRHIPTEMNNLNQEEISRYVDLDSCDYVVDVDMPQSDREPDFRKMEDNWKPVDSLPFIDVSKSTGFHGLLRAFYVPFLSAKHNVMTTCTLYRKSNL | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016757 | IEA:UniProtKB-KW | F | transferase activity, transferring glycosyl groups |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| cel01100 | Metabolic pathways |
| cel00510 | N-Glycan biosynthesis |
| ko00510 | N-Glycan biosynthesis |
REACTOME Pathway Links
| REACTOME Pathway ID | Description |
|---|---|
| 5652981 | Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR005599 | GPI mannosyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Similarity | Belongs to the glycosyltransferase 22 family. {ECO:0000305}. |
| Subcellular Location | Endoplasmic reticulum membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP007954 (as displayed in Record Overview)
Identical Sequences to LMP007954 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32564301 | EMBL | CAA90107.2 | 603 | Protein C14A4.3 [Caenorhabditis elegans] |
| GI:32564301 | SwissProt | P54002.2 | 603 | RecName: Full=Putative glycosyltransferase C14A4.3 [Caenorhabditis elegans] |
Related Sequences to LMP007954 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:32564301 | EMBL | CAP23568.2 | 604 | Protein CBG03061 [Caenorhabditis briggsae] |
| GI:32564301 | EMBL | CDJ91310.1 | 641 | Alg9 mannosyltransferase domain containing protein [Haemonchus contortus] |
| GI:32564301 | GenBank | EFO27810.1 | 651 | plasmid Maintenance protein containing protein [Loa loa] |
| GI:32564301 | GenBank | EGT45008.1 | 586 | hypothetical protein CAEBREN_09175 [Caenorhabditis brenneri] |
| GI:32564301 | GenBank | ETN84661.1 | 959 | plasmid Maintenance Protein, partial [Necator americanus] |
| GI:32564301 | RefSeq | XP_002631257.1 | 549 | Hypothetical protein CBG03061, partial [Caenorhabditis briggsae] |