Gene/Proteome Database (LMPD)
Proteins
| Protein ACL-3 | |
|---|---|
| Refseq ID | NP_502202 |
| Protein GI | 392900899 |
| UniProt ID | Q23598 |
| mRNA ID | NM_069801 |
| Length | 284 |
| RefSeq Status | REVIEWED |
| MSGTMRDKTNDVQGFRFAWPFPKKPSLLYRIKSYMTMSLVTSVSKLMFLGGSNKLICHNKETFVKILENPNQPLITVSNHRSNIDDPLMWCILKFREFWRYKDRNRYTLAAHNICFTKQFHTTMFSLGRCVPCVRGEGVYQKGMDFCVDMLNDNKWVHIFPEGKVCTLESEPLRFKWGIGRLVMDAKTDPVILPVWCKEMEKVWPTQPPYYPKFGNTVTVHIGEPFFLSDLKKTVLSKSLTTEQMRKIITDEVQTRMYQLGEKVGDLPKGSSLEILRKNPPIEY | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016746 | IEA:InterPro | F | transferase activity, transferring acyl groups |
| GO:0006644 | IEA:InterPro | P | phospholipid metabolic process |
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP007992 (as displayed in Record Overview)
Identical Sequences to LMP007992 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:392900899 | EMBL | CAA92638.2 | 284 | Protein ACL-3 [Caenorhabditis elegans] |
Related Sequences to LMP007992 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:392900899 | EMBL | CAP26275.1 | 248 | Protein CBR-ACL-3 [Caenorhabditis briggsae] |
| GI:392900899 | GenBank | EFO93675.1 | 304 | CRE-ACL-3 protein [Caenorhabditis remanei] |
| GI:392900899 | GenBank | EFP04684.1 | 284 | hypothetical protein CRE_09867 [Caenorhabditis remanei] |
| GI:392900899 | GenBank | EGT37695.1 | 284 | hypothetical protein CAEBREN_18051 [Caenorhabditis brenneri] |
| GI:392900899 | RefSeq | XP_003090776.1 | 284 | hypothetical protein CRE_09867 [Caenorhabditis remanei] |
| GI:392900899 | RefSeq | XP_003107776.1 | 304 | CRE-ACL-3 protein [Caenorhabditis remanei] |