Gene/Proteome Database (LMPD)

LMPD ID
LMP008007
Gene ID
Species
Caenorhabditis elegans (C. elegans)
Gene Name
Protein DHS-16
Gene Symbol
Synonyms
CELE_C10F3.2
Alternate Names
Protein DHS-16
Chromosome
V
EC Number
1.1.1.-

Proteins

Protein DHS-16
Refseq ID NP_504554
Protein GI 17557780
UniProt ID O16881
mRNA ID NM_072153
Length 388
RefSeq Status REVIEWED
MLELIYILPLLCFVYFLFRRFVLENFYVESSGKYVMITGCDSGFGRLLATSLLDKHVNVFAACFTQQGMASLHSEWKLKKGPKGQLYTLQLDVTSQASVDSAKSFVTKILKEQNSKLWGLVNNAGIFSIHGPDDWCSVDEYASSLNVNTLGAVRMCHAFVPLIKKSRGRIVTMGSTAGRLHGLYVAPYVTAKFAVEAYMDCLRLEMRPFGVSVHILEPGCFKTELLNNDAQRMRIQKIWNSLSVETKEEYGEDYRNDFERAWEAGVNVVANPNIGWVVDCYSHALFSWWPRLRYCPGWDAIFMFIPLSIFPTALQDWILAGLYKLNPGPSLTPAVLVKNKKRRSAIQWIQFLSQIAIIPLLYTIFFVKNTQKQTVETSTHHHNVTVSE

Gene Information

Entrez Gene ID
Gene Name
Protein DHS-16
Gene Symbol
Species
Caenorhabditis elegans

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0016229 IDA:UniProtKB F steroid dehydrogenase activity
GO:0008203 IEA:UniProtKB-KW P cholesterol metabolic process
GO:0055114 IDA:UniProtKB P oxidation-reduction process

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR020904 Short-chain dehydrogenase/reductase, conserved site
IPR002198 Short-chain dehydrogenase/reductase SDR

UniProt Annotations

Entry Information

Gene Name
Protein DHS-16
Protein Entry
DHS16_CAEEL
UniProt ID
Species
C. elegans

Comments

Comment Type Description
Function 3 beta-hydroxysteroid dehydrogenase that converts 3 beta-hydroxysteroids to 3-ketosteroids, an essential step in the production of delta(7)-dafachronic acid from cholesterol. Dafachronic acids bind directly to the nuclear hormone receptor (NHR) daf-12, suppressing dauer formation and inducing reproductive growth. Required for longevity in the absence of the germline. {ECO:0000269|PubMed:22505847}.
Pathway Steroid hormone biosynthesis; dafachronic acid biosynthesis. {ECO:0000269|PubMed:22505847}.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}.
Subcellular Location Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}.
Tissue Specificity Strongly expressed in the hypodermis and posterior pharyngeal bulb and in a number of unidentified neurons of the head and tail. {ECO:0000269|PubMed:22505847}.

Identical and Related Proteins

Unique RefSeq proteins for LMP008007 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
17557780 RefSeq NP_504554 388 Protein DHS-16

Identical Sequences to LMP008007 proteins

Reference Database Accession Length Protein Name
GI:17557780 EMBL CCD64121.1 388 Protein DHS-16 [Caenorhabditis elegans]
GI:17557780 GenBank ABZ32402.1 388 Sequence 6340 from patent US 7314974
GI:17557780 SwissProt O16881.1 388 RecName: Full=3 beta-hydroxysteroid dehydrogenase dhs-16 [Caenorhabditis elegans]

Related Sequences to LMP008007 proteins

Reference Database Accession Length Protein Name
GI:17557780 EMBL CAP29283.1 387 Protein CBR-DHS-16 [Caenorhabditis briggsae]
GI:17557780 GenBank EFP11065.1 416 CRE-DHS-16 protein [Caenorhabditis remanei]
GI:17557780 GenBank EGT47029.1 387 CBN-DHS-16 protein [Caenorhabditis brenneri]
GI:17557780 GenBank ETN70378.1 389 hypothetical protein NECAME_04930 [Necator americanus]
GI:17557780 RefSeq XP_002636827.1 387 C. briggsae CBR-DHS-16 protein [Caenorhabditis briggsae]
GI:17557780 RefSeq XP_003112544.1 416 CRE-DHS-16 protein [Caenorhabditis remanei]