Gene/Proteome Database (LMPD)
Proteins
| Protein DHS-16 | |
|---|---|
| Refseq ID | NP_504554 |
| Protein GI | 17557780 |
| UniProt ID | O16881 |
| mRNA ID | NM_072153 |
| Length | 388 |
| RefSeq Status | REVIEWED |
| MLELIYILPLLCFVYFLFRRFVLENFYVESSGKYVMITGCDSGFGRLLATSLLDKHVNVFAACFTQQGMASLHSEWKLKKGPKGQLYTLQLDVTSQASVDSAKSFVTKILKEQNSKLWGLVNNAGIFSIHGPDDWCSVDEYASSLNVNTLGAVRMCHAFVPLIKKSRGRIVTMGSTAGRLHGLYVAPYVTAKFAVEAYMDCLRLEMRPFGVSVHILEPGCFKTELLNNDAQRMRIQKIWNSLSVETKEEYGEDYRNDFERAWEAGVNVVANPNIGWVVDCYSHALFSWWPRLRYCPGWDAIFMFIPLSIFPTALQDWILAGLYKLNPGPSLTPAVLVKNKKRRSAIQWIQFLSQIAIIPLLYTIFFVKNTQKQTVETSTHHHNVTVSE | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0016229 | IDA:UniProtKB | F | steroid dehydrogenase activity |
| GO:0008203 | IEA:UniProtKB-KW | P | cholesterol metabolic process |
| GO:0055114 | IDA:UniProtKB | P | oxidation-reduction process |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | 3 beta-hydroxysteroid dehydrogenase that converts 3 beta-hydroxysteroids to 3-ketosteroids, an essential step in the production of delta(7)-dafachronic acid from cholesterol. Dafachronic acids bind directly to the nuclear hormone receptor (NHR) daf-12, suppressing dauer formation and inducing reproductive growth. Required for longevity in the absence of the germline. {ECO:0000269|PubMed:22505847}. |
| Pathway | Steroid hormone biosynthesis; dafachronic acid biosynthesis. {ECO:0000269|PubMed:22505847}. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. {ECO:0000305}. |
| Subcellular Location | Membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Tissue Specificity | Strongly expressed in the hypodermis and posterior pharyngeal bulb and in a number of unidentified neurons of the head and tail. {ECO:0000269|PubMed:22505847}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP008007 (as displayed in Record Overview)
Identical Sequences to LMP008007 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17557780 | EMBL | CCD64121.1 | 388 | Protein DHS-16 [Caenorhabditis elegans] |
| GI:17557780 | GenBank | ABZ32402.1 | 388 | Sequence 6340 from patent US 7314974 |
| GI:17557780 | SwissProt | O16881.1 | 388 | RecName: Full=3 beta-hydroxysteroid dehydrogenase dhs-16 [Caenorhabditis elegans] |
Related Sequences to LMP008007 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:17557780 | EMBL | CAP29283.1 | 387 | Protein CBR-DHS-16 [Caenorhabditis briggsae] |
| GI:17557780 | GenBank | EFP11065.1 | 416 | CRE-DHS-16 protein [Caenorhabditis remanei] |
| GI:17557780 | GenBank | EGT47029.1 | 387 | CBN-DHS-16 protein [Caenorhabditis brenneri] |
| GI:17557780 | GenBank | ETN70378.1 | 389 | hypothetical protein NECAME_04930 [Necator americanus] |
| GI:17557780 | RefSeq | XP_002636827.1 | 387 | C. briggsae CBR-DHS-16 protein [Caenorhabditis briggsae] |
| GI:17557780 | RefSeq | XP_003112544.1 | 416 | CRE-DHS-16 protein [Caenorhabditis remanei] |